Recombinant Probable sulfate transport system permease protein cysT (cysT)

Shipped with Ice Packs
In Stock

Description

Role in Sulfate Uptake and Regulation

The ABC permease mediates sulfate import via an ATP-dependent mechanism:

  • ATP Hydrolysis: CysA binds and hydrolyzes ATP, providing energy for sulfate translocation .

  • Substrate Specificity: Primarily transports sulfate (SO42SO_4^{2-}) but also thiosulfate (S2O32S_2O_3^{2-}) in some systems .

  • Regulation by Cell Density: In E. coli, sulfate uptake is density-dependent, linked to sulfate depletion in rich media .

Table 2: Kinetic Parameters and Inhibitors

Parameter/InhibitorValue/EffectSource OrganismReference
Kₘ (sulfate)0.1 μM (Sbp in S. typhimurium)S. typhimurium
Kₘ (sulfate)36 μM (Sbp in M. tuberculosis)M. tuberculosis
InhibitorsSulfite, selenate, thiosulfate, NEM, CCCPE. coli

Escherichia coli Studies

  • CysTWA Dependency: Sulfate uptake in E. coli requires functional cysT, CysW, and CysA. Mutations in these genes impair transport .

  • Role of Periplasmic Binders: The cysP and sbp genes encode thiosulfate and sulfate binders, respectively. Single mutants retain sulfate/thiosulfate transport, but double mutants become cysteine auxotrophs .

  • Cell Density Effects: Sulfate uptake peaks in late log/saturation phases, suggesting regulation by quorum sensing or nutrient availability .

Mycobacterium tuberculosis Studies

  • Interaction with SulP Proteins: The SulP protein Rv1739c (SLC26 family) enhances sulfate uptake in E. coli but requires CysA for activity. This suggests a cooperative role between SulP and ABC permeases in M. tuberculosis .

  • Transmembrane Domain Necessity: Overexpression of Rv1739c’s transmembrane domain (aa 1–436) boosts sulfate uptake, while the STAS domain (aa 437–560) is non-essential .

  • Cysteine Mutations: Cys-less Rv1739c mutants retain sulfate transport activity, indicating cysteine residues are not critical for function .

Experimental Evidence and Data

  • Recombinant Expression: Overexpression of cysT-related proteins (e.g., Rv1739c in E. coli) increases sulfate uptake by 2–3 fold in a pH-dependent manner (optimal at pH 6.0) .

  • Inhibitor Sensitivity: Sulfate transport is inhibited by sulfite, selenate, and thiosulfate, but not by phosphate or bicarbonate .

  • Functional Complementation: Rv1739c cannot complement sulfate auxotrophy in M. bovis BCG lacking CysA, emphasizing the ABC system’s indispensability .

Interactions with Other Transporters

  • SulT vs. CysZ Systems: While the ABC system (SulT) is high-affinity, the CysZ transporter in Corynebacterium glutamicum operates at lower affinities and is regulated by sulfite .

  • SulP Synergy: In M. tuberculosis, SulP proteins like Rv1739c may augment sulfate uptake by interacting with the ABC permease, though direct evidence remains limited .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them when placing the order. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery information.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate with us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer ingredients, temperature, and the intrinsic stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
cysT; Probable sulfate transport system permease protein cysT
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-255
Protein Length
full length protein
Species
Prototheca wickerhamii
Target Names
cysT
Target Protein Sequence
MLGNHLFFIPVLPLFALFSLILKNSWKDILEKAVDPIAICAYGFTIKMALIAALFNSIFG FLITWVITRYEFKGKKFIDAAVDLPFALPTSVAGLTLATVYGNQGWVGRFLKMGNLQIIY TKFGVLLAMIFVSFPFVIRSLQPVLQGLDHGLEEAAWCLGASSFQTFLRVIFPTLVPALV TGFTLSFSRALGEFGSVVMISSNLPLDDLVTSVLIYQSLEQYDYFGASVIGAVILMIALL IIFLINTAQAFYSRR
Uniprot No.

Target Background

Function
This protein, cysT, is a component of the ABC transporter complex cysAWTP (TC 3.A.1.6.1), which is involved in the transport of sulfate and thiosulfate into the cell. It is likely responsible for the translocation of the substrate across the membrane.
Protein Families
Binding-protein-dependent transport system permease family, CysTW subfamily
Subcellular Location
Plastid membrane; Multi-pass membrane protein.

Q&A

What is CysT protein and what is its primary function in bacterial systems?

CysT is an integral membrane polypeptide that forms part of the sulfate permease system in bacteria. It functions as a channel component for the transport of sulfate across the cytoplasmic membrane. The protein contains a high level of nonpolar amino acids (61.5%), which is typical of many membrane transport proteins . CysT works in conjunction with other proteins in the sulfate transport system, including CysA (the ATP-binding protein), CysW (another membrane protein), and substrate-binding proteins like SbpA (sulfate-binding protein) .

Methodological approach: To study CysT function, researchers typically employ gene interruption experiments followed by growth assays using various sulfur sources. For example, mutant strains in which cysT was interrupted were not viable when grown with sulfate as the sole sulfur source, confirming its essential role in sulfate transport .

Which model organisms are most suitable for studying CysT function?

Several bacterial systems have been used to study CysT, with the most well-characterized being:

  • Synechococcus sp. strain PCC 7942 (cyanobacterium)

  • Escherichia coli K-12

  • Salmonella typhimurium

Comparative studies have shown that the CysT polypeptide in Synechococcus is 42% identical in amino acid sequence to the analogous protein from E. coli . Preliminary sequence data has also revealed strictly homologous counterparts of the E. coli cysP and cysT genes in Salmonella typhimurium .

Methodological approach: When selecting a model organism for CysT studies, consider:

  • The availability of genetic tools for the organism

  • Growth characteristics and ease of culture

  • Existing knowledge base and comparative data

  • Relevance to your specific research question (e.g., environmental vs. medical applications)

How is the cysT gene organized within bacterial operons?

The cysT gene is part of a sulfur-regulated operon. In Synechococcus, cysT is located downstream of sbpA (encoding the sulfate-binding protein) and is transcribed in the same direction . The TGA termination codon of cysP (thiosulfate-binding protein) overlaps with the putative ATG initiation codon of cysT in E. coli K-12, suggesting translational coupling and coordinated expression of these genes .

In Synechococcus, the complete organization appears to be:

  • cysA (ATP-binding protein)

  • sbpA (sulfate-binding protein)

  • cysT (membrane channel protein)

  • cysR (regulatory protein with homology to prokaryotic regulatory proteins)

  • cysW (another membrane channel protein)

Methodological approach: To analyze operon structure, researchers typically use a combination of:

  • DNA sequencing

  • Northern blot hybridization to define transcriptional units

  • Promoter mapping via primer extension

  • Bioinformatic analysis of intergenic regions

What are the optimal expression systems for recombinant CysT production?

When expressing membrane proteins like CysT, several considerations must be addressed:

  • E. coli expression systems: While commonly used, may have limitations for membrane proteins due to potential toxicity. Studies have shown that constitutive expression of similar SulP polypeptides can be toxic in bacterial systems .

  • Controlled expression systems: The T7 promoter-polymerase system has been successfully used for controlled expression of related transport proteins .

  • Alternative hosts: For difficult-to-express membrane proteins, consider systems such as:

    • Lactococcus lactis

    • Bacillus subtilis

    • Cell-free expression systems

Methodological approach: Start with an inducible expression system (like IPTG-inducible promoters) that allows tight control of expression levels. Monitor growth curves following induction to assess toxicity. If toxicity is observed, reduce inducer concentration or lower growth temperature (16-20°C) to slow protein production.

What purification strategies are most effective for recombinant CysT?

As an integral membrane protein with multiple transmembrane domains, CysT presents challenges for purification.

Methodological approach:

  • Membrane isolation: Prepare bacterial membranes via differential centrifugation

  • Solubilization: Test multiple detergents (DDM, LMNG, digitonin) at different concentrations

  • Affinity purification: Use N- or C-terminal tags (His6, FLAG, etc.)

  • Size exclusion chromatography: As a final polishing step to ensure protein homogeneity

  • Stability assessment: Monitor protein stability using techniques like thermal shift assays

Consider the following tag placements for optimal results:

  • N-terminal tags if C-terminus is involved in function

  • C-terminal tags if N-terminus contains signal sequences

How can researchers reliably measure CysT-mediated sulfate transport activity?

Several complementary approaches can be used:

  • Whole-cell uptake assays: Measure the uptake of radiolabeled sulfate (35S-sulfate) in cells expressing wild-type or mutant CysT .

  • Reconstitution in proteoliposomes: For direct mechanistic studies, purified CysT can be reconstituted into liposomes, followed by measuring sulfate uptake.

  • Growth complementation: Assess the ability of recombinant CysT to restore growth of cysT-deficient strains on media with sulfate as the sole sulfur source .

Methodological considerations:

  • Control for expression levels when comparing mutants

  • Include appropriate inhibitors as negative controls

  • Measure initial rates to determine kinetic parameters

  • Consider pH dependence (optimal activity reported at pH 6.0, with inhibition at pH 5.0)

What is the relationship between CysT and other components of the sulfate transport system?

CysT functions as part of a multi-component system. Current evidence suggests:

  • CysA dependency: Increased sulfate uptake associated with overexpression of related sulfate transporters requires CysA (the ATP-binding subunit of the ABC sulfate permease) .

  • Cooperative function: CysT likely forms a channel together with CysW, creating a pathway for sulfate transport across the cytoplasmic membrane .

  • System architecture: The complete system involves:

    • Periplasmic binding proteins (SbpA for sulfate, CysP for thiosulfate)

    • Membrane-spanning proteins (CysT, CysW)

    • ATP-binding protein (CysA) for energy coupling

Methodological approach: To study these interactions, researchers can use:

  • Co-immunoprecipitation or pull-down assays

  • Bacterial two-hybrid systems

  • In vitro reconstitution of the complete transport system

  • Sequential gene knockout/complementation experiments

What structural features are critical for CysT function?

While detailed structural information is limited, functional studies suggest:

  • Transmembrane topology: CysT has multiple predicted transmembrane segments consistent with its role as a channel-forming protein .

  • Amino acid composition: The high level of nonpolar amino acids (61.5%) is typical of membrane transport proteins .

  • Conserved regions: Sequence alignment between CysT proteins from different species can identify highly conserved regions that may be functionally important.

Methodological approach: To investigate structure-function relationships:

  • Generate a series of targeted mutations in conserved regions

  • Create chimeric proteins between CysT from different species

  • Perform cysteine-scanning mutagenesis to identify critical residues

  • Use computational modeling to predict structural features

Are cysteine residues essential for CysT function?

Studies on related sulfate transporters have addressed this question directly:

A Cys-less variant (where all cysteine residues were mutagenized to serine) of a related sulfate transporter showed no reduction in IPTG-induced increase in sulfate uptake, suggesting that cysteine residues are not essential for the basic transport function .

This finding is significant because:

  • It indicates that disulfide bonds are not critical for the functional structure

  • It provides a valuable substrate for scanning cysteine accessibility mutagenesis studies

  • It suggests that NEM inhibition of transport likely affects other proteins in the system

Methodological approach: When investigating the role of cysteines:

  • Create Cys-to-Ser mutants individually and in combination

  • Test functional properties using transport assays

  • Explore the accessibility of introduced cysteines using MTS reagents

  • Assess the pH-dependence of transport activity in wild-type vs. Cys-less variants

How does the substrate specificity of CysT compare with other sulfate transporters?

The CysT-containing transport system appears to have distinct substrate specificity:

  • Sulfate vs. thiosulfate transport: While the CysA mutant strain could not grow on either sulfate or thiosulfate, cysT and cysW mutants were still capable of slow growth on thiosulfate . This suggests:

    • CysA is involved in transport of multiple sulfur-containing compounds

    • CysT and CysW may be more specific for sulfate transport

    • Alternative transporters might exist for thiosulfate

  • Comparison with eukaryotic transporters: Unlike some eukaryotic SLC26 sulfate transporters:

    • The bacterial system showed no inhibition by extracellular HCO3-

    • No evidence was found for sulfate/bicarbonate exchange mechanisms

    • The bacterial system lacked oxalate transport capability and was not inhibited by oxalate

Methodological approach: To analyze substrate specificity:

  • Test transport of various 35S-labeled compounds

  • Perform competition assays with unlabeled potential substrates

  • Compare growth on different sulfur sources

  • Measure transport rates at varying substrate concentrations to determine kinetic parameters

How can researchers effectively study the regulation of cysT expression?

The cysT gene is part of the sulfur-regulated gene network. To study its regulation:

  • Promoter analysis: The CysB-dependent promoter controls expression of the sulfate-thiosulfate transport system in E. coli K-12 .

  • Transcription start site mapping: This has been accomplished using primer extension techniques .

  • Response to sulfur limitation: Northern hybridizations with large DNA fragments as probes have defined five sulfur-regulated transcripts within a 7-kbp region adjacent to cysA in Synechococcus .

Methodological approach:

  • Construct reporter gene fusions (e.g., lacZ, gfp) to monitor expression

  • Perform quantitative RT-PCR under various growth conditions

  • Use gel shift assays to identify regulatory protein binding sites

  • Employ ChIP-seq to map genome-wide binding of regulatory factors

  • Create targeted mutations in predicted regulatory elements

What are the current limitations in studying CysT transport kinetics and how can they be overcome?

Several challenges exist in studying CysT transport kinetics:

  • Multi-component nature: CysT functions as part of a complex with other proteins, making it difficult to isolate its specific contribution.

  • Membrane integration: As an integral membrane protein, studying CysT in isolation requires proper reconstitution into a membrane environment.

  • Energy coupling: The dependence on ATP hydrolysis via CysA adds complexity to kinetic analyses.

Methodological approaches to overcome these limitations:

  • Reconstitution systems:

    • Proteoliposomes with co-reconstituted CysT, CysW, and CysA

    • Nanodiscs for single-molecule studies

    • Planar lipid bilayers for electrophysiology

  • Advanced biophysical techniques:

    • Solid-state NMR to study membrane protein structure

    • Single-molecule FRET to analyze conformational changes

    • Cryo-EM for structural determination

  • Computational approaches:

    • Molecular dynamics simulations of transport mechanisms

    • Quantum mechanics/molecular mechanics modeling of substrate binding

How does CysT function differ across bacterial species?

Comparative analysis reveals both conservation and variation:

The CysT polypeptide from Synechococcus is 42% identical in amino acid sequence to the analogous protein from E. coli , indicating substantial conservation of core functional elements while allowing for species-specific adaptations.

Preliminary sequence data has shown that Salmonella typhimurium contains strictly homologous counterparts of the E. coli cysP and cysT genes , suggesting strong evolutionary conservation of this transport system among enterobacteria.

SpeciesCysT SizeIdentity to E. coli CysTGrowth Phenotype of cysT Mutants
Synechococcus sp. PCC 7942278 aa42%No growth on sulfate as sole sulfur source
E. coli K-12Similar100% (reference)Essential for sulfate transport
Salmonella typhimuriumSimilarHigh (strict homology)Not reported in detail

Methodological approach: For comparative studies:

  • Perform phylogenetic analysis of CysT sequences across bacterial phyla

  • Test functional complementation across species

  • Create chimeric proteins to identify species-specific functional domains

  • Compare regulation of expression in different ecological niches

How has the evolution of the CysT protein contributed to bacterial adaptation to different environments?

This is an emerging area of research. Several hypotheses can be tested:

  • Sulfur availability adaptation: CysT variants may have evolved different affinities for sulfate in response to environmental sulfur availability.

  • pH adaptation: The observed pH-dependence of transport (optimum at pH 6.0) may reflect adaptation to specific environmental niches.

  • Host infection strategies: In pathogenic bacteria like M. tuberculosis, sulfate transporters may play roles during host infection that differ from free-living bacteria.

Methodological approach:

  • Compare CysT sequences from bacteria in sulfur-rich vs. sulfur-poor environments

  • Analyze expression patterns under different environmental conditions

  • Test growth and transport capabilities across a range of pH and ionic conditions

  • Examine the contribution of CysT to virulence in pathogenic species

How can CRISPR-Cas9 technologies enhance the study of CysT function?

CRISPR-Cas9 offers several advantages for CysT research:

  • Precise genome editing: Create clean deletions or point mutations in the native cysT gene.

  • CRISPRi for regulated knockdown: Use catalytically inactive Cas9 (dCas9) fused to repressor domains to achieve titratable repression of cysT expression.

  • CRISPRa for overexpression: Use dCas9 fused to activator domains to enhance native cysT expression.

  • Multiplex targeting: Simultaneously modify multiple components of the sulfate transport system.

Methodological approach:

  • Design guide RNAs targeting conserved regions of cysT

  • Include appropriate controls for off-target effects

  • Consider the use of base editors for precise nucleotide changes

  • Implement inducible CRISPR systems for temporal control

What potential biotechnological applications exist for engineered CysT proteins?

Several promising applications could be developed:

  • Bioremediation: Engineered bacteria with enhanced sulfate uptake could be used for:

    • Removal of sulfate from contaminated water

    • Recovery of sulfur from industrial waste streams

    • Bioremediation of acid mine drainage

  • Biosensors: CysT-based biosensors could monitor:

    • Environmental sulfate levels

    • Sulfur cycling in aquatic ecosystems

    • Soil sulfate content for agricultural applications

  • Metabolic engineering: Enhanced sulfate uptake could improve:

    • Production of sulfur-containing amino acids

    • Synthesis of sulfated biomolecules

    • Growth of industrial microorganisms in sulfur-limited media

Methodological approach:

  • Screen for CysT variants with enhanced transport capacity

  • Engineer bacteria with controlled expression of the complete transport system

  • Develop immobilization strategies for whole-cell applications

  • Test performance under relevant environmental conditions

What strategies can address the toxicity often associated with membrane protein overexpression?

Overexpression of membrane proteins like CysT can be toxic to host cells. Research on related sulfate transporters has reported toxicity upon constitutive expression .

Effective strategies include:

  • Tightly controlled induction systems:

    • Use lower concentrations of inducers

    • Implement temperature-sensitive or nutrient-dependent promoters

    • Consider auto-induction media for gradual protein expression

  • Growth conditions optimization:

    • Lower temperature during expression (16-20°C)

    • Adjust media composition (e.g., supplement with specific ions)

    • Optimize cell density at induction

  • Fusion partners and modifications:

    • N-terminal fusion partners that enhance folding

    • Removal of potentially toxic domains

    • Codon optimization for the expression host

Methodological approach: When troubleshooting toxicity:

  • Test multiple expression strains

  • Perform time-course experiments to identify onset of toxicity

  • Consider dual-plasmid systems where chaperones are co-expressed

  • Monitor protein quality throughout optimization process

How can researchers distinguish between direct and indirect effects when studying CysT function?

This is a critical question for accurate interpretation of experimental results.

Methodological approaches:

  • Multiple lines of evidence:

    • Combine genetic, biochemical, and biophysical approaches

    • Validate findings across different experimental systems

  • Appropriate controls:

    • Include catalytically inactive mutants

    • Test related transporters with different specificities

    • Use specific inhibitors when available

  • Reconstitution experiments:

    • Reconstitute minimal systems with defined components

    • Add components sequentially to identify their contributions

    • Use purified proteins to confirm direct interactions

  • In vitro vs. in vivo correlation:

    • Validate findings from isolated systems in intact cells

    • Consider physiological conditions when interpreting results

    • Account for potential compensatory mechanisms in vivo

This approach is particularly important given the finding that CysA is required for enhanced sulfate uptake associated with overexpression of related transporters , suggesting complex interactions between components of the transport system.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.