Recombinant Probable ubiquinone biosynthesis protein UbiB (ubiB)

Shipped with Ice Packs
In Stock

Description

Introduction to UbiB Protein

UbiB is classified as a probable ubiquinone biosynthesis protein that plays a key role in the oxygen-dependent pathway for ubiquinone production . The protein has been identified in multiple bacterial species, including various strains of Escherichia coli, Salmonella enterica, and Chromobacterium violaceum . Functionally, UbiB demonstrates ATPase activity and is categorized as a probable protein kinase (EC 2.7) .

The significance of UbiB lies in its contribution to cellular bioenergetics through ubiquinone biosynthesis. Ubiquinone, also known as coenzyme Q, is a lipid-soluble electron carrier that functions as a critical component of the electron transport chain in bacterial respiration . The ability to produce recombinant UbiB provides researchers with valuable tools to study ubiquinone biosynthesis mechanisms and their implications for bacterial metabolism and adaptation.

General Characteristics

UbiB is characterized as a protein comprised of 546 amino acids in length in several bacterial species including Escherichia coli and Salmonella enterica . The protein exists in various bacterial strains including E. coli O9:H4 (strain HS) and E. coli O127:H6 (strain E2348/69 / EPEC), suggesting its conservation across different lineages . This conservation indicates the fundamental importance of UbiB in bacterial metabolism, particularly in energy production pathways.

Overview of Ubiquinone and Its Importance

Ubiquinone is a lipid-soluble molecule with a crucial role in cellular bioenergetics . It functions as an electron carrier in the electron transport chain, facilitating aerobic respiration in many bacterial species. The biosynthesis of ubiquinone is particularly important for bacteria that encounter environments with varying oxygen levels, as it allows them to adapt their respiratory metabolism accordingly .

The complete ubiquinone biosynthetic pathway requires a series of reactions to modify the aromatic ring of the precursor, 4-hydroxybenzoic acid (4-HB), including one prenylation, one decarboxylation, three hydroxylation, and three methylation reactions . The complexity of this pathway highlights the sophisticated biochemical machinery that bacteria employ to synthesize this essential component of their respiratory chain.

UbiB's Role in the Biosynthetic Pathway

In the context of the ubiquinone biosynthetic pathway, UbiB serves as an accessory factor with demonstrated ATPase activity . While the exact biochemical mechanism of UbiB's action remains to be fully elucidated, its classification as a probable protein kinase (EC 2.7) suggests it may be involved in phosphorylation events that regulate the biosynthetic process .

UbiB is specifically involved in the oxygen-dependent pathway for ubiquinone biosynthesis . This pathway requires molecular oxygen (O₂) as a substrate for certain reactions, particularly hydroxylation steps. UbiB's specific contribution to this pathway involves its ATPase activity, which likely supports the energetic requirements of certain biosynthetic reactions .

Dual Pathways for Ubiquinone Biosynthesis

Recent research has revealed the existence of two distinct pathways for ubiquinone biosynthesis in bacteria: an oxygen-dependent pathway and an oxygen-independent pathway . This dual pathway system represents an important adaptive feature in proteobacteria, allowing them to synthesize ubiquinone across the entire range of environmental oxygen levels.

Table 2: Comparison of Oxygen-Dependent and Oxygen-Independent Ubiquinone Biosynthesis Pathways

FeatureOxygen-Dependent PathwayOxygen-Independent PathwayReference
Key ProteinsUbiB and othersUbiT, UbiU, UbiV
Oxygen RequirementRequires O₂ as substrateFunctions independently of O₂
UbiB FunctionATPase activityNot involved in this pathway
UbiU-UbiV FunctionNot involved in this pathwayForm heterodimer with 4Fe-4S clusters
UbiT FunctionNot involved in this pathwayContains SCP2 lipid-binding domain
Environmental ContextAerobic conditionsAnaerobic or varying O₂ levels

The Oxygen-Independent Alternative

In contrast to the UbiB-associated oxygen-dependent pathway, an oxygen-independent pathway for ubiquinone biosynthesis has been identified that relies on three proteins: UbiT (YhbT), UbiU (YhbU), and UbiV (YhbV) . This alternative pathway allows bacteria to synthesize ubiquinone even in anoxic environments, providing metabolic flexibility.

UbiT contains an SCP2 lipid-binding domain and likely functions as an accessory factor, while UbiU and UbiV form a heterodimer that acts as a novel class of oxygen-independent hydroxylases, each binding a 4Fe-4S cluster essential for activity . The identification of this oxygen-independent pathway highlights the remarkable metabolic adaptability of proteobacteria, enabling them to maintain essential respiratory functions across diverse environmental conditions.

Evolutionary and Ecological Significance

The presence of both oxygen-dependent and oxygen-independent pathways for ubiquinone biosynthesis represents an important adaptive feature in proteobacteria. This metabolic plasticity enables these organisms to colonize environments with large oxygen gradients or fluctuating oxygen levels . Such adaptations have been linked to antibiotic resistance, virulence, and the capacity to thrive in complex ecosystems like the microbiota .

Expression Systems for Recombinant UbiB

Recombinant UbiB protein can be produced using various expression systems. According to the available research, these systems include Escherichia coli, yeast, baculovirus, or mammalian cell expression platforms . The choice of expression system depends on factors such as desired yield, post-translational modifications, and the intended application of the recombinant protein.

Table 3: Expression Systems for Recombinant UbiB Production

Expression SystemAdvantagesLimitationsReferenced In
Escherichia coliHigh yield, simple cultivationLimited post-translational modifications
YeastEukaryotic modifications, secretionLonger cultivation time
BaculovirusComplex eukaryotic modificationsMore complex, higher cost
Mammalian CellMost authentic modificationsHighest cost, lowest yield

Available Recombinant Forms

Several recombinant forms of UbiB are available for research purposes, including:

  1. Recombinant E. coli UbiB Protein (aa 1-546) from strain HS

  2. Recombinant E. coli UbiB Protein (aa 1-546) from strain E2348/69 / EPEC

  3. Recombinant Chromobacterium violaceum Probable ubiquinone biosynthesis protein UbiB (partial)

These recombinant proteins serve as valuable tools for studying the structure, function, and biochemical properties of UbiB in controlled laboratory settings. It is important to note that these products are explicitly designated for research purposes only and cannot be used directly on humans or animals .

Research Applications

Recombinant UbiB enables several important research applications:

  1. Structural studies to investigate the three-dimensional organization and functional domains of this important biosynthetic enzyme

  2. Functional assays to characterize its enzymatic activities, including its reported ATPase function and potential protein kinase activity

  3. Pathway analysis to understand the regulation and efficiency of the oxygen-dependent ubiquinone biosynthetic pathway

  4. Comparative studies examining UbiB function across different bacterial species

UbiB in Escherichia coli

UbiB has been extensively studied in E. coli, a gram-negative, facultatively anaerobic, rod-shaped bacterium that serves as a model organism in microbiology and biotechnology . In E. coli, UbiB exists as a 546-amino acid protein involved in the oxygen-dependent pathway for ubiquinone biosynthesis .

Different strains of E. coli express UbiB, including strain HS (O9:H4) and strain E2348/69 (O127:H6, EPEC) . The protein's conservation across these strains suggests its fundamental importance in E. coli metabolism and energy production.

UbiB in Other Bacterial Species

UbiB has also been identified in Salmonella enterica subsp. enterica serovar Dublin strain CT_02021853 as a 546-amino acid protein . The computed structure model available for Salmonella UbiB (UniProtKB: B5FNW8) provides insights into its three-dimensional organization and potential functional domains .

Additionally, UbiB has been identified in Chromobacterium violaceum, where it is similarly described as a probable ubiquinone biosynthesis protein . The presence of UbiB across these diverse bacterial species demonstrates the conservation of the ubiquinone biosynthetic pathway and highlights its evolutionary importance.

Pathway Regulation and Adaptation

The discovery of dual pathways for ubiquinone biosynthesis—oxygen-dependent and oxygen-independent—raises questions about how bacteria regulate these alternative routes . Future research could explore the conditions that favor one pathway over the other and the mechanisms that control pathway switching in response to environmental oxygen levels.

Such investigations could provide insights into bacterial adaptation to varying environmental conditions, with potential implications for understanding bacterial survival in diverse ecological niches, including host environments during infection.

Therapeutic and Biotechnological Potential

While the recombinant UbiB proteins described are explicitly limited to research applications , further investigation of ubiquinone biosynthesis could potentially reveal new therapeutic targets. The link between metabolic adaptability, antibiotic resistance, and virulence suggests that modulating ubiquinone biosynthesis might offer novel approaches to combating bacterial infections .

Additionally, understanding UbiB function and ubiquinone biosynthesis may have applications in biotechnology, potentially contributing to the development of engineered bacterial strains with enhanced or modified respiratory capabilities for industrial processes.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement, and we will prepare accordingly.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipping is required, please notify us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure all contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid forms is 6 months at -20°C/-80°C. For lyophilized forms, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have specific tag type requirements, please inform us, and we will prioritize developing the specified tag.
Synonyms
ubiB; aarF; c4784; Probable protein kinase UbiB; Ubiquinone biosynthesis protein UbiB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-546
Protein Length
full length protein
Species
Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Target Names
ubiB
Target Protein Sequence
MTPGEVRRLYFIIRTFLSYGLDELIPKMRITLPLRLWRYSLFWMPNRHKDKPLGERLRLA LQELGPVWIKFGQMLSTRRDLFPPHIADQLALLQDKVAPFDGKLAKQQIEAAMGGLPVEA WFDDFEIKPLASASIAQVHTARLKSNGKEVVIKVIRPDILPVIKADLKLIYRLARWVPRL LPDGRRLRPTEVVREYEKTLIDELNLLRESANAIQLRRNFEDSPMLYIPEVYPDYCSEGM MVMERIYGIPVSDVATLEKNGTNMKLLAERGVQVFFTQVFRDSFFHADMHPGNIFVSYEH PENPKYIGIDCGIVGSLNKEDKRYLAENFIAFFNRDYRKVAELHVDSGWVPPDTNVEEFE FAIRTVCEPIFEKPLAEISFGHVLLNLFNTARRFNMEVQPQLVLLQKTLLYVEGVGRQLY PQLDLWKTAKPFLESWIKDQVGIPALVRAFKEKAPFWVEKMPELPELVYDSLRQGKYLQH SVDKIARELQSNHVRQGQSRYFLGIGATLVLSGTFLLVSRPEWGLMPGWLMAGGLIAWFV GWRKTR
Uniprot No.

Target Background

Function
This protein is likely a protein kinase regulator of UbiI activity, which plays a role in the aerobic biosynthesis of coenzyme Q (ubiquinone).
Database Links

KEGG: ecc:c4784

STRING: 199310.c4784

Protein Families
ABC1 family, UbiB subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the role of UbiB in ubiquinone biosynthesis pathways?

UbiB is a probable ubiquinone biosynthesis protein involved in the production of ubiquinone (coenzyme Q), an essential component of the electron transport chain. While specific information about UbiB is limited in the current literature, it likely functions as part of the cellular machinery responsible for synthesizing ubiquinone. Research suggests that ubiquinone biosynthesis in bacteria can occur through both O₂-dependent and O₂-independent pathways, with various Ubi proteins playing crucial roles in these processes . To investigate UbiB's specific function, researchers typically employ genetic approaches such as gene knockout studies, complementation assays, and protein-protein interaction studies to determine its position in the biosynthetic pathway.

How does UbiB relate to other ubiquinone biosynthesis proteins like UbiT, UbiU, and UbiV?

UbiB likely functions in concert with other ubiquinone biosynthesis proteins. Recent research has characterized novel proteins such as UbiT, UbiU, and UbiV that form part of an O₂-independent pathway for ubiquinone biosynthesis . UbiT contains an SCP2 lipid-binding domain and likely serves as an accessory factor, while UbiU and UbiV function as O₂-independent hydroxylases that form a heterodimer complex with 4Fe-4S clusters essential for activity . To determine UbiB's relationship with these proteins, researchers should conduct co-immunoprecipitation studies, yeast two-hybrid screens, or proximity-based labeling experiments. Comparative genomic analysis across bacterial species can also reveal evolutionary relationships and functional associations between these proteins.

What are the structural characteristics of recombinant UbiB protein?

While specific structural data for UbiB is not directly available in the provided sources, recombinant protein expression systems similar to those used for UBE4B could be employed to produce UbiB for structural analysis . Typically, recombinant proteins are expressed with tags (such as His-tags) to facilitate purification and characterization . For structural studies of UbiB, researchers should consider expression in eukaryotic systems like baculovirus-infected insect cells, which often provide better protein folding for complex proteins . X-ray crystallography, nuclear magnetic resonance (NMR) spectroscopy, or cryo-electron microscopy could then be employed to elucidate UbiB's three-dimensional structure, active sites, and potential binding domains.

What is the optimal experimental design to study UbiB function in vivo?

For in vivo studies of UbiB function, researchers should consider implementing single-subject experimental designs (SSEDs) that allow for rigorous assessment of cause-and-effect relationships . A withdrawal design (ABA/ABAB) could be particularly effective, where condition A represents wild-type expression and condition B represents UbiB deletion or modification . This approach allows researchers to observe how cellular function changes with the manipulation of UbiB and confirms causality by demonstrating reversibility . The conservative dual-criterion (CDC) method can be applied to analyze results, requiring a predetermined number of data points above both level and trend lines to conclude that systematic change has occurred . For example, in a 10-data point treatment phase, at least 8 points should fall above both criteria lines to indicate a significant effect .

How can researchers address the issue of UbiB functional redundancy in experimental designs?

To address potential functional redundancy between UbiB and other biosynthesis proteins, researchers should implement a multiple-baseline design across conditions . This approach involves creating multiple genetic constructs with different combinations of gene knockouts or modifications. Data analysis should follow the conservative dual-criterion (CDC) method to determine whether systematic changes occur when manipulating UbiB alone versus in combination with other genes . For each comparison in an ABAB design, researchers can break the analysis into three separate AB designs (initial AB, BA, second AB) and analyze each separately to determine if systematic changes occur across phases . This approach helps to isolate UbiB's specific contribution to ubiquinone biosynthesis even in the presence of potential redundant pathways.

What controls are necessary when assessing UbiB activity in O₂-dependent versus O₂-independent conditions?

When investigating UbiB's role across different oxygen conditions, researchers must implement careful controls. Since ubiquinone biosynthesis can occur through both O₂-dependent and O₂-independent pathways , experiments should be designed to measure UbiB activity across a range of oxygen concentrations. Critical controls include:

Control TypePurposeImplementation
Positive controlsVerify assay functionalityInclude known O₂-dependent proteins (e.g., UbiF)
Negative controlsEstablish baselineAssay with inactive protein variants
System controlsValidate oxygen conditionsUse established O₂-sensitive and resistant processes
Genetic controlsIsolate UbiB functionCompare wild-type, knockout, and complemented strains

Researchers should also consider measuring activity of known O₂-independent proteins like UbiU-UbiV as comparators, since these form a heterodimer with 4Fe-4S clusters that are essential for their hydroxylase activity in anaerobic conditions .

What analytical techniques are most effective for monitoring UbiB-mediated reactions in real-time?

For real-time monitoring of UbiB-mediated reactions, researchers should consider combining spectroscopic and chromatographic techniques. While no specific method for UbiB is mentioned in the provided sources, approaches similar to those used for studying UBE4B activity could be adapted . For monitoring ubiquitination reactions catalyzed by E3 ligases like UBE4B, in vitro assays typically employ concentrations of 100-500 nM depending on experimental conditions and substrate . For UbiB, researchers might develop similar in vitro assays with appropriate substrates and cofactors, monitoring activity through:

  • Fluorescence resonance energy transfer (FRET) with labeled substrates

  • High-performance liquid chromatography (HPLC) to quantify reaction products

  • Mass spectrometry to identify chemical modifications

  • Oxygen consumption measurements using oxygen-sensitive probes

These approaches would allow researchers to observe UbiB activity under various conditions and determine kinetic parameters such as Km and Vmax.

How can researcher̥s address the challenges of studying membrane-associated proteins like UbiB?

Many ubiquinone biosynthesis proteins are membrane-associated, which presents unique challenges for biochemical characterization. To address these challenges, researchers should consider:

  • Using detergent-based extraction methods optimized for membrane proteins

  • Employing nanodiscs or liposomes to maintain a lipid environment

  • Utilizing membrane mimetics for structural studies

  • Implementing in situ approaches like fluorescence recovery after photobleaching (FRAP)

For expression of membrane proteins, baculovirus-infected insect cell systems similar to those used for UBE4B may provide better results than bacterial expression systems . Additionally, carrier-free protein preparations can be valuable for certain applications where adding carriers like BSA might interfere with downstream analyses .

What computational approaches can assist in predicting UbiB function and interactions?

Computational methods can provide valuable insights into UbiB function ahead of experimental validation. Researchers should consider:

  • Sequence-based analyses including multiple sequence alignments and phylogenetic profiling to identify conserved domains and co-evolving proteins

  • Structural prediction using homology modeling or ab initio approaches

  • Molecular dynamics simulations to predict protein-substrate interactions

  • Genome context analyses to identify functionally related genes

These computational predictions can guide experimental design, particularly for determining potential binding partners, substrates, or functional domains within UbiB. Integration of computational and experimental approaches offers the most comprehensive strategy for characterizing this probable ubiquinone biosynthesis protein.

What statistical methods are most appropriate for analyzing UbiB activity data from multiple experimental conditions?

For quantitative analysis of UbiB function in different oxygen conditions, a utility-based Bayesian optimal interval (U-BOIN) approach could be adapted from clinical trial designs to optimize experimental conditions . This would involve:

  • Developing a utility function that measures the trade-off between different experimental parameters

  • Jointly modeling multiple outcome variables using a multinomial-Dirichlet model

  • Updating posterior estimates after each experimental iteration

  • Using these estimates to direct subsequent experimental conditions

This approach enables researchers to efficiently explore the parameter space while accumulating data on UbiB activity under various conditions .

How should researchers interpret conflicting results when studying UbiB in different model systems?

When facing conflicting results across different model systems, researchers should implement a systematic approach to resolve discrepancies:

  • Evaluate the experimental design quality using established criteria (like those in Table 1 from source )

  • Conduct visual analysis supplemented with formal methods like CDC to determine if systematic effects are present

  • Assess whether experimental effects have been sufficiently replicated within each study to rule out extraneous variables

  • Consider contextual factors that might explain differences between model systems

What approaches can address the challenge of delayed effects in UbiB-related experimental results?

When studying UbiB's role in ubiquinone biosynthesis, researchers may encounter delayed effects where changes in measurements don't immediately follow experimental manipulations. This latency can call into question whether the independent variable (UbiB manipulation) is truly responsible for observed changes . To address this challenge, researchers should:

  • Ensure experimental effects are replicated within the study to rule out extraneous variables

  • Implement designs that accommodate delayed responses, such as extended baseline and intervention phases

  • Consider adapting methods from clinical trial design that handle delayed outcomes by leveraging short-term endpoints to predict delayed outcomes

For example, researchers might measure immediate changes in gene expression or protein localization as predictors of later changes in ubiquinone levels. The utility-based Bayesian optimal interval (U-BOIN) design could be particularly useful, as it consists of two seamless stages: an initial exploration stage followed by a more focused investigation based on preliminary data .

How can findings from UbiB research be applied to understand ubiquinone deficiency disorders?

Research on UbiB and other ubiquinone biosynthesis proteins has significant implications for understanding ubiquinone deficiency disorders. Since ubiquinone plays a crucial role in cellular bioenergetics, dysfunction in its biosynthesis pathway can lead to mitochondrial diseases . Researchers investigating these connections should:

  • Establish clear genotype-phenotype correlations between UbiB variants and clinical presentations

  • Develop cellular and animal models with UbiB mutations that recapitulate disease phenotypes

  • Design intervention studies that target specific steps in the affected pathway

These studies would benefit from single-subject experimental designs (SSEDs) to track individual responses to interventions, particularly when patient populations are small . The withdrawal design (ABAB) would be especially valuable for testing potential treatments, though ethical considerations regarding withdrawing effective interventions must be carefully considered .

What novel experimental approaches could advance our understanding of UbiB structure-function relationships?

To advance understanding of UbiB structure-function relationships, researchers should consider integrating cutting-edge technologies:

  • Cryo-electron microscopy to visualize UbiB alone and in complex with interaction partners

  • Hydrogen-deuterium exchange mass spectrometry to map dynamic regions and binding interfaces

  • Single-molecule techniques to observe conformational changes during catalysis

  • CRISPR-based approaches for precise genomic editing to study UbiB variants

Expression systems similar to those used for UBE4B could be adapted, potentially using baculovirus-infected insect cells to produce properly folded recombinant UbiB . Adding affinity tags (like the His6 tag used for UBE4B) would facilitate purification while maintaining protein function . For certain applications, carrier-free protein preparations would be valuable to avoid interference from carrier proteins in downstream analyses .

How might UbiB function differ across bacterial species with varying oxygen adaptations?

The discovery of both O₂-dependent and O₂-independent pathways for ubiquinone biosynthesis suggests that bacteria have evolved sophisticated mechanisms to maintain energy metabolism across different oxygen environments . UbiB's function may vary across bacterial species depending on their oxygen adaptations. To investigate these differences, researchers should:

  • Conduct comparative genomic analyses across alpha-, beta-, and gammaproteobacterial clades

  • Perform functional complementation studies across species

  • Measure UbiB activity in microaerobic and anaerobic conditions

  • Investigate the relationship between UbiB and O₂-independent proteins like UbiU-UbiV

This research has particular relevance for understanding pathogens that must navigate host environments with varying oxygen levels . The ability to synthesize ubiquinone across the entire O₂ range represents an important metabolic adaptation that may contribute to bacterial survival in complex ecosystems like the human microbiota .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.