Recombinant Procavia capensis habessinica Aquaporin-2 (AQP2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks to ensure fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us for preferential development.
Synonyms
AQP2; Aquaporin-2; AQP-2; ADH water channel; Aquaporin-CD; AQP-CD; Collecting duct water channel protein; WCH-CD; Water channel protein for renal collecting duct; Fragment
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-109
Protein Length
full length protein
Species
Procavia capensis habessinica (Abyssinian hyrax)
Target Names
AQP2
Target Protein Sequence
SIAFSRAVLSEFLATLLFVFFGLGSALNWPQALPSVLQIAMAFGLAIGTLVQTLGHISGAHINPAVTIACLVGCHVSFLRALFYLAAQLLGAVAGAALLHELTPPDIRG
Uniprot No.

Target Background

Function

Forms a water-specific channel in the plasma membranes of renal collecting duct cells. This high water permeability allows water movement along osmotic gradients.

Protein Families
MIP/aquaporin (TC 1.A.8) family
Subcellular Location
Apical cell membrane; Multi-pass membrane protein. Basolateral cell membrane; Multi-pass membrane protein. Cell membrane; Multi-pass membrane protein. Cytoplasmic vesicle membrane; Multi-pass membrane protein. Golgi apparatus, trans-Golgi network membrane; Multi-pass membrane protein.

Q&A

What is Aquaporin-2 (AQP2) and what is its physiological function?

Aquaporin-2 (AQP2) is a transmembrane protein that forms water channels across cell membranes, primarily in the kidneys . It is found in the collecting ducts, which are small tubular structures responsible for water reabsorption from the kidneys into the bloodstream . AQP2 is sometimes referred to by alternative names including ADH water channel, Aquaporin-CD, collecting duct water channel protein (WCH-CD), and water channel protein for renal collecting duct .

The primary physiological function of AQP2 is maintaining the body's water balance through regulated water reabsorption . When fluid intake is low or significant fluid is lost (through mechanisms like sweating), a hormone called arginine vasopressin (AVP) or antidiuretic hormone (ADH) is released from the brain . This hormone triggers a cascade of chemical reactions that results in the insertion of AQP2 water channels into the membrane of collecting duct cells, allowing water to be reabsorbed into the bloodstream and producing more concentrated urine . Conversely, when fluid intake is adequate, less AVP is released, AQP2 channels are removed from the membrane, and more dilute urine is produced .

What is the relationship between AQP2 and arginine vasopressin (AVP)?

AQP2 and arginine vasopressin (AVP) have a critical regulatory relationship in maintaining water homeostasis . AVP (also known as antidiuretic hormone or ADH) is produced and stored in the brain and released in response to dehydration or increased plasma osmolality . When released, AVP triggers a signaling cascade that culminates in the translocation of AQP2 water channels from intracellular vesicles to the apical membrane of collecting duct cells in the kidney .

The placement and abundance of AQP2 water channels in the cell membrane are directly controlled by AVP levels . This relationship is fundamental to the kidneys' ability to concentrate urine and conserve water when necessary . Disruptions in this relationship, such as mutations in the AQP2 gene, can lead to a condition called arginine vasopressin resistance, characterized by excessive urine production (polyuria) and extreme thirst (polydipsia) . Most AQP2 gene variants that cause this condition result in misfolded proteins that remain trapped within the cell or functional channels that are misrouted and cannot reach the cell membrane .

How does phosphorylation regulate AQP2 function in cell volume regulation?

Phosphorylation of AQP2, particularly at serine 256 (S256), plays a critical role in regulating the protein's function in cell volume regulation, specifically during regulatory volume decrease (RVD) . RVD is a cellular defense mechanism against hypotonic stress that is particularly important in kidney collecting duct cells, which are routinely subjected to osmolality changes .

Research using MDCK cells has demonstrated that stable expression of AQP2 increases RVD capacity, while AQP2 phosphorylation levels decrease during the RVD process . Studies with phosphorylation mutants have revealed that both S256A (preventing phosphorylation) and S256D (mimicking constitutive phosphorylation) mutations decrease RVD compared to wild-type AQP2 . Interestingly, only the S256A mutation decreases initial osmotic swelling, suggesting that AQP2-enhanced RVD operates independently of the osmotic swelling induced by AQP2's water permeability function .

In contrast, mutations at serine 261 (S261A and S261D) do not induce significant changes compared to wild-type AQP2 . These findings indicate that the dynamic switching between phosphorylation and dephosphorylation at S256 is critically important for effective RVD, rather than the static phosphorylation state .

What is the significance of the AQP2-tropomyosin 5b interaction in cellular processes?

The interaction between AQP2 and tropomyosin 5b (TM5b) represents a significant mechanism in cell volume regulation . TM5b is known to regulate actin stability, an important factor in cellular structure and function . Research has shown that AQP2 interactions with TM5b are rapidly increased by hypotonicity and then subsequently decreased, a pattern that correlates with AQP2 phosphorylation levels .

Experimental manipulation of TM5b levels through knockdown and overexpression techniques has demonstrated its essential role in wild-type AQP2-enhanced regulatory volume decrease (RVD) . Notably, RVD in cells expressing S256A-AQP2 or S256D-AQP2 is not affected by TM5b knockdown or overexpression, further highlighting the importance of the phosphorylation state of serine 256 in mediating AQP2-TM5b interactions .

This evidence suggests a model where AQP2 regulates RVD via its interaction with TM5b, with the dynamic phosphorylation and dephosphorylation at S256 being crucial for this process . This mechanism provides insight into how water channels can influence cellular processes beyond simple water transport, connecting water homeostasis to cytoskeletal dynamics and cell volume regulation.

What are the molecular consequences of AQP2 gene mutations and how do they relate to physiological disorders?

Mutations in the AQP2 gene can lead to significant physiological disorders, primarily arginine vasopressin resistance . At the molecular level, most AQP2 gene variants associated with this condition result in one of two primary defects: protein misfolding or protein misrouting .

In the case of protein misfolding, the mutated AQP2 cannot achieve its correct three-dimensional structure and becomes trapped within the cell, typically in the endoplasmic reticulum . These misfolded proteins are unable to reach the cell membrane to fulfill their function as water transporters . In contrast, some mutations result in correctly folded and functional AQP2 water channels, but these channels are misrouted within the cell and never reach the apical membrane of the collecting duct cells where they are needed .

The physiological consequences of these molecular defects are excessive urine production (polyuria) and extreme thirst (polydipsia) . Because the kidneys cannot properly reabsorb water without functional AQP2 channels in the correct location, water is lost in the urine, leading to dehydration and compensatory thirst . This condition represents a form of nephrogenic diabetes insipidus, where the kidneys fail to respond appropriately to AVP despite normal or elevated levels of the hormone.

What are the optimal storage and handling conditions for recombinant AQP2 protein?

Proper storage and handling of recombinant Procavia capensis habessinica AQP2 are critical for maintaining protein integrity and experimental reproducibility . The shelf life of recombinant AQP2 depends on several factors, including storage state, buffer composition, storage temperature, and the inherent stability of the protein itself .

For liquid formulations of recombinant AQP2, the recommended storage temperature is -20°C or -80°C, with an expected shelf life of approximately 6 months under these conditions . Lyophilized (freeze-dried) formulations have greater stability, with a shelf life of approximately 12 months when stored at -20°C or -80°C .

Researchers should avoid repeated freezing and thawing cycles, as this can significantly compromise protein integrity . For ongoing experiments, working aliquots can be stored at 4°C for up to one week . When preparing aliquots for long-term storage, it's advisable to use small volumes to minimize the number of freeze-thaw cycles and to use a buffer system that optimizes protein stability.

The recombinant AQP2 is typically provided in a Tris-based buffer containing 50% glycerol, which has been optimized for this specific protein . This buffer composition helps maintain protein stability during storage and handling procedures.

What experimental systems are most appropriate for studying AQP2 function?

Several experimental systems have proven effective for studying AQP2 function, with the choice depending on the specific aspect of AQP2 biology under investigation. Cell culture systems, particularly MDCK (Madin-Darby Canine Kidney) cells, have been successfully used to study AQP2 trafficking, phosphorylation, and its role in cell volume regulation . These cells can be stably transfected to express wild-type or mutant AQP2, allowing for comparative studies of protein function .

For studying the regulatory mechanisms of AQP2, experimental systems that allow manipulation of vasopressin signaling are valuable . These can include ex vivo kidney slice preparations or in vitro systems with AVP receptor expression. Cell systems expressing phosphorylation mutants (such as S256A, S256D, S261A, and S261D variants) have been particularly informative for understanding the role of phosphorylation in AQP2 function .

Methods for studying protein-protein interactions, such as AQP2's interaction with tropomyosin 5b, include co-immunoprecipitation, FRET (Fluorescence Resonance Energy Transfer), and knockdown/overexpression approaches . These techniques have revealed the dynamic nature of these interactions in response to changes in osmolality and their importance in cellular processes like regulatory volume decrease .

For functional studies of water permeability, techniques such as stopped-flow light scattering, which measures the rate of cell swelling or shrinking in response to osmotic gradients, can provide quantitative data on AQP2 channel activity .

What are the key considerations for designing experiments to investigate AQP2 phosphorylation dynamics?

Designing experiments to investigate AQP2 phosphorylation dynamics requires careful consideration of several factors. Based on research findings, the phosphorylation status of specific residues, particularly serine 256, plays a crucial role in AQP2 function and protein interactions .

A comprehensive experimental approach should include:

  • Phosphorylation-specific antibodies: Using antibodies that specifically recognize phosphorylated forms of AQP2 (at S256, S261, and other sites) enables detection of phosphorylation status under various conditions .

  • Phosphorylation mutants: Creating and expressing phosphorylation-deficient (e.g., S256A) and phosphomimetic (e.g., S256D) mutants allows for the investigation of how phosphorylation at specific sites affects AQP2 function, trafficking, and protein interactions .

  • Temporal resolution: Since phosphorylation events can be rapid and transient, experiments should be designed with appropriate time points to capture the dynamic nature of these modifications, particularly in response to stimuli like osmotic stress .

  • Combined protein interaction studies: As phosphorylation status affects protein interactions (e.g., with TM5b), combining phosphorylation studies with interaction assays provides a more complete picture of the regulatory mechanisms .

  • Functional readouts: Including functional measurements, such as water permeability or regulatory volume decrease capacity, alongside phosphorylation measurements establishes the physiological significance of observed phosphorylation changes .

When investigating the switch between phosphorylation and dephosphorylation at S256, which has been shown to be particularly important for processes like RVD, experiments should include conditions that promote both states and measure the dynamics of transition between them .

What evolutionary insights can be gained from studying Procavia capensis habessinica AQP2?

Studying Aquaporin-2 from Procavia capensis habessinica (Abyssinian hyrax) provides valuable evolutionary insights due to the species' unique physiological adaptations and phylogenetic position. Rock hyraxes (Procavia capensis) are particularly interesting subjects for comparative physiology as they are the most arid-adapted of hyrax species, inhabiting dry mountainous regions in the Namib, Sahara, and Arabian deserts .

The evolutionary adaptations of desert-dwelling mammals to water conservation are likely reflected in the structure and function of their water regulatory proteins, including AQP2. Procavia capensis has several physiological adaptations that suggest sophisticated water conservation mechanisms, including the practice of communal urination and defecation in designated areas called latrines, which may reduce water loss .

From a phylogenetic perspective, despite their small size, hyraxes are more closely related to elephants and sea cows than to rodents or other small mammals . This makes their AQP2 an interesting subject for studying the evolution of water regulation proteins across diverse mammalian taxa. The unusually long gestation period (6-8 months) for an animal of its size is thought to reflect that its ancestors were much larger in body size , suggesting potential evolutionary conservation of physiological mechanisms including water regulation.

Comparative analysis of AQP2 sequences and function across species that have adapted to different environmental conditions can provide insights into the evolutionary pressures shaping water conservation mechanisms and the structural elements of aquaporins that are essential for their function.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.