Recombinant Prochlorococcus marinus Apocytochrome f (petA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during ordering for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for customers.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
petA; P9515_05251; Cytochrome f
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
35-317
Protein Length
Full Length of Mature Protein
Species
Prochlorococcus marinus (strain MIT 9515)
Target Names
petA
Target Protein Sequence
YPFWAQQNYESPREATGKIVCANCHLAQMPTIAEVPQAVGADSVFKAVVKIPYKDDIKEI GADGSEVPLQVGAVVMLPDGFKLAPQERWTDEIKEETEGVYFTNYSEEKENIIIVGPLPG DTNKEIIFPVLSPNPATNKEYHYGKYSLHIGGNRGRGQVYPTGDKSNNVIFTSSSAGTIN SIETIEDGSYQINIENENGEITTEAVPVGPKLIVKEQDQITVGAPLTSDPNVGGFGQLDA EVVLQSPYRIIGLIAFFIGVGLTQILLVLKKKQVEKVQAAEGI
Uniprot No.

Target Background

Function
A component of the cytochrome b6-f complex. This complex facilitates electron transfer between Photosystem II (PSII) and Photosystem I (PSI), cyclic electron flow around PSI, and state transitions.
Database Links
Protein Families
Cytochrome f family
Subcellular Location
Cellular thylakoid membrane; Single-pass membrane protein.

Q&A

Basic Research Questions

  • What is Prochlorococcus marinus and why is it significant for photosynthesis research?

    Prochlorococcus marinus is a minute photosynthetic marine prokaryote of exceptional significance in global carbon cycling. With a diameter of only 0.5-0.7 μm, it is the smallest known photosynthetic organism and presumed to be the most abundant photosynthetic organism on Earth . It dominates the photosynthetic biomass in oligotrophic areas of oceans between 40°S and 40°N latitudes, typically dividing once daily in the subsurface layer . What makes Prochlorococcus particularly distinctive is its unique pigment complement, which includes divinyl derivatives of chlorophyll a and b (Chl a₂ and Chl b₂), and in some strains, small amounts of a novel type of phycoerythrin . Its genome is extremely compact - among the smallest of any photosynthetic organism - with P. marinus SS120 having a single circular chromosome of 1,751,080 bp with a G+C content of just 36.4% . This minimal genome makes it an excellent model for studying essential photosynthetic processes.

  • What is Apocytochrome f (petA) and what role does it play in Prochlorococcus physiology?

    Apocytochrome f, encoded by the petA gene, is a crucial component of the cytochrome b₆/f complex in the photosynthetic electron transport chain of Prochlorococcus marinus. The mature cytochrome f functions within this complex to mediate electron transfer between photosystem II and photosystem I. In Prochlorococcus marinus, the petA gene (PMT_1323 in strain MIT 9313) encodes a protein that, after processing, becomes an integral membrane protein with a heme group covalently attached .

    The biosynthesis of functional cytochrome f is a multistep process involving:

    1. Translation of the precursor protein (pre-apocytochrome f)

    2. Processing to remove the signal sequence

    3. Covalent ligation of a c-type heme group

    4. Proper membrane insertion

    Studies have revealed that the alpha-amino group of Tyr1, generated upon cleavage of the signal sequence from the precursor protein, serves as one axial ligand of the c-heme in cytochrome f .

  • What are the optimal storage and handling conditions for Recombinant Prochlorococcus marinus Apocytochrome f?

    Based on standard protocols for recombinant Prochlorococcus marinus Apocytochrome f, the following conditions are recommended for optimal storage and handling :

    ParameterRecommendation
    Storage bufferTris-based buffer with 50% glycerol, optimized for protein stability
    Short-term storage4°C for up to one week
    Long-term storage-20°C, or -80°C for extended storage
    Freeze-thaw cyclesMinimize; repeated freezing and thawing is not recommended
    Working aliquotsStore at 4°C for up to one week

    When designing experiments with this protein, researchers should consider preparing multiple small aliquots during initial thawing to avoid repeated freeze-thaw cycles that could compromise protein structure and function. The relatively high glycerol content (50%) in the storage buffer helps maintain protein stability during freezing but should be considered when calculating final concentrations in experimental setups .

  • What expression systems are suitable for producing Recombinant Prochlorococcus marinus Apocytochrome f?

    Successfully expressing Prochlorococcus marinus proteins presents unique challenges due to the organism's low G+C content (36.82% for P. marinus SS120) and consequent codon bias. When designing expression systems for recombinant Apocytochrome f, researchers should consider:

    Expression SystemConsiderations
    E. coliMost common; requires codon optimization due to Prochlorococcus' AT-rich bias. May need specialized strains with c-type cytochrome maturation systems for proper heme incorporation
    Yeast systemsCan provide better folding for membrane proteins but may require signal sequence optimization
    Cell-free systemsAllows control of translation environment but may have limitations for heme incorporation

    Methodological approaches should include:

    1. Codon optimization accounting for the unique codon usage of Prochlorococcus, which is shifted toward A or T at the third base position (T>A>C>G)

    2. Inclusion of appropriate signal sequences for proper protein targeting

    3. Co-expression with heme lyase or complete c-type cytochrome maturation systems to ensure proper heme attachment

    4. Careful design of purification strategies that maintain the native conformation of the membrane-associated domains

Advanced Research Questions

  • How does the structure-function relationship of Apocytochrome f differ between high-light and low-light adapted Prochlorococcus ecotypes?

    Prochlorococcus marinus exists as genetically distinct ecotypes adapted to different light intensities in the water column, with high-light adapted genotypes in upper waters and low-light adapted genotypes in deeper waters . These adaptations affect their photosynthetic apparatus, including potential variations in cytochrome b₆/f components like Apocytochrome f.

    Comparative analysis methodologies for studying these differences include:

    1. Sequence comparison: Analysis of petA genes from strains like high-light adapted MED4 and low-light adapted SS120 reveals adaptive variations. Low-light adapted strains show sequence modifications that may optimize electron transport under limited light conditions.

    2. Electron transport kinetics: Measure electron transfer rates through cytochrome b₆/f using oxygen evolution measurements or chlorophyll fluorescence techniques under varying light intensities.

    3. Protein-protein interaction studies: Investigate differences in interaction between cytochrome f and its electron acceptors (plastocyanin or cytochrome c₆) using techniques such as:

      • Surface plasmon resonance

      • Isothermal titration calorimetry

      • Cross-linking followed by mass spectrometry

    4. Redox potential measurements: Compare midpoint potentials of cytochrome f from different ecotypes using potentiometric titrations, which may reveal adaptations in electron transfer efficiency.

    Low-light adapted strains like SS120 may have evolved cytochrome f variants that optimize electron transfer under limited photon flux, possibly through altered redox potentials or modified protein-protein interaction surfaces that enhance electron transfer efficiency under their specific light environment .

  • What experimental approaches can determine the interplay between protein processing and heme attachment in Prochlorococcus Apocytochrome f?

    The biosynthesis of functional cytochrome f involves coordination between signal sequence processing and heme attachment. Based on studies of cytochrome f biogenesis in other organisms, several methodological approaches can be employed to investigate this interplay in Prochlorococcus:

    1. Site-directed mutagenesis: Modify the consensus cleavage site for thylakoid processing peptidase (e.g., replacing the AQA sequence with LQL as demonstrated in Chlamydomonas reinhardtii) . This approach can reveal whether heme binding is a prerequisite for cytochrome f processing or vice versa.

    2. Substitution of heme-binding cysteine residues: Replace the conserved cysteine residues responsible for covalent ligation of the c-heme with valine and leucine to investigate the role of heme binding in protein processing and stability .

    3. Pulse-chase experiments: Track the rates of synthesis and degradation of various forms of cytochrome f (precursor vs. processed, with or without heme) to understand the temporal relationship between processing and heme attachment.

    4. Chloroplast transformation with modified genes: Express modified versions of petA in model organisms to study in vivo effects of sequence alterations on protein maturation .

    5. Immunoprecipitation and mass spectrometry: Identify intermediate forms during the maturation process and their associated protein partners.

    Previous research in Chlamydomonas has shown that:

    • Heme binding is not a prerequisite for cytochrome f processing

    • Pre-apocytochrome f can adopt a suitable conformation for the cysteinyl residues to be substrates for heme lyase

    • Pre-holocytochrome f can fold in an assembly-competent conformation

    These approaches could determine if similar processes occur in Prochlorococcus and identify any unique aspects of cytochrome f biogenesis in this minimal genome organism.

  • How does the low G+C content of Prochlorococcus genomes affect the expression and evolutionary trajectory of petA?

    Prochlorococcus marinus strains are characterized by unusually low G+C content, with P. marinus SS120 having a genomic G+C content of 36.82% . This AT-rich bias has significant implications for petA expression and evolution:

    1. Codon usage bias:
      The codon usage of P. marinus SS120 is shifted toward A or T at the third base position (T>A>C>G), indicating mutational biases as the likely cause . For experimental work, this bias necessitates codon optimization when expressing recombinant proteins in heterologous systems.

    2. Oligonucleotide design considerations:
      When designing primers for PCR amplification or probes for detection of petA, researchers must account for the AT-rich nature of the sequence to ensure specific binding and optimal annealing temperatures.

    3. Evolutionary implications:
      The AT-rich bias likely reflects genome streamlining during Prochlorococcus evolution. Comparative analysis methods to investigate this include:

      MethodApplication to petA research
      dN/dS analysisCalculates ratio of non-synonymous to synonymous substitutions to detect selection pressure on petA sequences
      Ancestral sequence reconstructionUses phylogenetic approaches to infer the sequence of ancestral petA versions
      Experimental evolutionTracks sequence changes in petA during adaptation to different light conditions
    4. Structural adaptations:
      The AT-rich codon bias may have led to adaptations in the amino acid composition of Apocytochrome f, potentially affecting protein stability and function in the marine environment. Researchers can investigate this through:

      • Computational analysis of amino acid composition compared to homologs from GC-rich genomes

      • Stability studies comparing wild-type proteins with synthetic variants using altered codon optimization

      • Thermal denaturation experiments to assess protein stability

    Understanding these implications is crucial when designing expression systems for recombinant Prochlorococcus proteins and interpreting evolutionary patterns in this ecologically important organism .

  • What is the role of Apocytochrome f in horizontal gene transfer between Prochlorococcus and marine phages?

    Marine cyanobacteria like Prochlorococcus are frequently infected by phages that can incorporate host genes into their genomes. While the search results don't specifically mention horizontal transfer of petA (Apocytochrome f), they do discuss related phenomena with other photosynthetic components that provide methodological approaches relevant to studying potential petA transfers:

    1. Metagenomic analysis approaches:

      • Screen marine metagenomic databases for phage-encoded petA homologs

      • Use phylogenetic analysis to distinguish between host-derived and phage-specific variants

      • Employ sequence similarity networks to detect evolutionary relationships between phage and host proteins

    2. Experimental methods to detect functional significance:

      • Heterologous expression systems to test if phage-encoded variants can complement host functions

      • Electron transport measurements comparing host and phage variants

      • Biophysical characterization of protein-protein interactions

    3. Relevance to electron transport:
      The search results indicate that marine phages encode ferredoxin electron carriers that can redirect energy harvested from light to phage-encoded oxidoreductases . Similar principles could apply to components of the cytochrome b₆/f complex:

      • Phage-encoded variants might optimize electron flow under specific conditions

      • Gene capture could provide selective advantages during infection

      • Modified components could redirect electron flow to support phage metabolism

    4. Experimental verification:
      Building on methodologies used for studying phage ferredoxins , researchers could:

      • Express putative phage petA in E. coli strains lacking functional cytochrome components

      • Test for complementation with host electron transport partners

      • Measure midpoint reduction potentials to assess functional properties

    This research direction could reveal important insights about the co-evolution of Prochlorococcus and its phages, potentially identifying novel adaptations in electron transport systems.

  • How can recombinant Apocytochrome f be used in synthetic biology applications mimicking minimal photosynthetic systems?

    Prochlorococcus marinus possesses one of the smallest genomes of any photosynthetic organism, making it an excellent model for minimal photosynthetic systems in synthetic biology applications. Recombinant Apocytochrome f, as a key component of the electron transport chain, offers several research opportunities:

    1. Reconstitution of minimal electron transport chains:

      • Purified recombinant Apocytochrome f can be combined with other minimal components (plastoquinone, plastocyanin or cytochrome c₆) in liposomes or nanodiscs

      • Electron transport can be measured using artificial electron donors and acceptors

      • This allows determination of the minimal components required for functional electron flow

    2. Design methodology for synthetic photosynthetic systems:

      StepApproach
      Component selectionIdentify minimal set of electron transport proteins from Prochlorococcus
      Protein engineeringModify domains for specific membrane targeting or self-assembly
      Assembly platformUse liposomes, nanodiscs, or synthetic membranes
      Functional testingMeasure electron transport rates, redox potentials, and energy conversion
    3. Applications in bioelectronic devices:

      • Immobilize recombinant Apocytochrome f on electrodes to create bio-hybrid electron transfer systems

      • Develop biophotoelectrochemical cells using minimal photosynthetic components

      • Design biosensors based on electron transfer properties

    4. Methodological considerations:

      • Expression of membrane proteins requires specialized systems with proper folding and heme incorporation capabilities

      • Post-translational modifications must be preserved or mimicked in recombinant systems

      • Stability in artificial environments may require protein engineering or optimized membrane mimetics

    The minimal genome of Prochlorococcus (1.66-1.75 Mbp) suggests that its photosynthetic apparatus represents a highly streamlined, efficient system . By isolating and reconstituting these components, researchers can develop minimal artificial photosynthetic systems with potential applications in solar energy conversion, biosensing, and fundamental photosynthesis research.

  • What cellular assays can be used to verify the functional activity of recombinant Prochlorococcus marinus Apocytochrome f?

    Verifying the functional activity of recombinant Apocytochrome f requires assays that assess its ability to participate in electron transfer reactions. Building on methodologies used for related proteins, researchers can employ several approaches:

    1. Complementation assays in model organisms:
      Similar to the approach used for testing phage ferredoxin function , researchers can:

      • Transform E. coli strains deficient in specific electron transport components

      • Co-express recombinant Apocytochrome f with partner proteins

      • Measure growth under conditions requiring functional electron transport

      Protocol outline:

      • Transform E. coli with plasmids expressing Apocytochrome f and partner proteins

      • Culture in selective media under appropriate conditions (temperature, inducers)

      • Measure growth rates and compare to positive and negative controls

    2. In vitro electron transport assays:

      Assay typeMethodology
      SpectroscopicMonitor redox state changes of cytochrome f using absorption spectroscopy at characteristic wavelengths (α-band ~554 nm)
      PolarographicMeasure oxygen consumption/evolution in reconstituted systems using oxygen electrodes
      ElectrochemicalUse protein film voltammetry to directly measure electron transfer to/from immobilized cytochrome f
    3. Protein-protein interaction verification:

      • Surface plasmon resonance to measure binding kinetics with plastocyanin/cytochrome c₆

      • Isothermal titration calorimetry to determine binding thermodynamics

      • FRET-based assays using fluorescently labeled partner proteins

    4. Structural verification approaches:

      • Circular dichroism spectroscopy to confirm secondary structure

      • Thermal shift assays to assess protein stability

      • Limited proteolysis to verify proper folding

    When designing these assays, researchers should consider the unique properties of Prochlorococcus proteins, including their adaptation to marine environments, potential lower thermal stability, and specific pH and salt requirements that reflect their native oceanic habitat .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.