Recombinant Prochlorococcus marinus Apolipoprotein N-acyltransferase (lnt)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Role

Apolipoprotein N-acyltransferase (Lnt) catalyzes the final step in lipoprotein maturation: the N-acylation of apolipoproteins using phospholipids as acyl donors. In Prochlorococcus marinus, a dominant marine cyanobacterium, this enzyme ensures proper anchoring of lipoproteins to the cell membrane, facilitating nutrient uptake and stress responses . The recombinant form is produced in Escherichia coli systems, enabling large-scale studies of its biochemical properties .

3.1. Lipoprotein Biosynthesis

  • Mechanism: Lnt transfers an acyl group from phospholipids to the N-terminal cysteine of apolipoproteins, forming triacylated lipoproteins essential for membrane integrity .

  • Ecological Impact: P. marinus lipoproteins contribute to its survival in oligotrophic marine environments, influencing global carbon cycling .

3.2. Substrate Specificity

  • Prefers phosphatidylethanolamine as the acyl donor in E. coli homologs , with likely conservation in P. marinus due to structural similarities.

5.1. Enzymatic Studies

  • Used to investigate lipoprotein maturation pathways in marine bacteria .

  • Comparative analyses with Mycobacterium Lnt homologs reveal conserved catalytic mechanisms .

5.2. Biotechnological Tools

  • Cloned into synthetic ORFeomes (e.g., MED4 and NATL1A strains) for systems biology exploration .

  • Facilitates genetic engineering of Prochlorococcus to study light adaptation and viral resistance .

Key Research Findings

  • Conformational Dynamics: Structural studies on E. coli Lnt reveal open/closed states during substrate binding, informing mechanistic models for P. marinus .

  • Ecotype Adaptations: LL (low-light) ecotypes of P. marinus exhibit unique chlorophyll-binding lipoproteins, potentially regulated by Lnt activity .

  • Conservation Across Species: Lnt homologs in Gram-positive Mycobacteria demonstrate triacylation using C16 and C19 fatty acids, highlighting evolutionary parallels .

Future Directions

  • Structural Biology: High-resolution crystallography of P. marinus Lnt to elucidate marine-specific adaptations.

  • Ecological Modeling: Linking lipoprotein diversity to Prochlorococcus niche specialization in oceanic ecosystems .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you require a specific format, please specify it in your order notes. We will prepare your order according to your needs.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery estimates.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate with us in advance, as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
The shelf life is influenced by multiple factors, including storage conditions, buffer composition, temperature, and the intrinsic stability of the protein.
Generally, the shelf life for the liquid form is 6 months at -20°C/-80°C. For the lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize its development.
Synonyms
lnt; Pro_1366; Apolipoprotein N-acyltransferase; ALP N-acyltransferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-494
Protein Length
full length protein
Species
Prochlorococcus marinus (strain SARG / CCMP1375 / SS120)
Target Names
lnt
Target Protein Sequence
MLALSRSKYFAFLTGTVGGLLAGVGLSQGGVVFIWISTACLWASMAFPSAVFLWGLFAIL LSYRWLLYLHPLTWIGVPIAFSLPIAILIWFSCGLLGGLLVALWSLIGQIPFFQRRLNSS TKDQLLYVIALSLIWGLVEVGLAKSPFFWFGLGDSLLPYDRWLAGLARWFGSGGLAALQL ILGWWVWKIIFAFKKGSPWLGLFALGVCSLLLAHCIGWILLADNEFTSSKRIALWQTNIP TRQKFTLRELKRLPISLQDALEEADNLGADWMVAPEGTLSAGQNLLAPSPLPLLSGGFRR VKNKQMSSLLVFNEGSTSYSSAIDKHRLVPLGEWLPSLPGVNWNGLSFVGGVDPGDASRF FDWDGGPLAVAICYELSDGNNLAKAIFDGAEWILAIANLDPYPISLQRQFLALAQLRSIE SARNLISVANTGPTSMILSSGKIKSIIEPFNEGVGVIDINVSQKISGYVRWGEIPLISSL LIVLCFIARLKGKA
Uniprot No.

Target Background

Function
This enzyme catalyzes the phospholipid-dependent N-acylation of the N-terminal cysteine of apolipoprotein, representing the final step in lipoprotein maturation.
Database Links
Protein Families
CN hydrolase family, Apolipoprotein N-acyltransferase subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Prochlorococcus marinus Apolipoprotein N-acyltransferase (lnt) and what is its biological function?

Apolipoprotein N-acyltransferase (lnt) from Prochlorococcus marinus is an integral membrane protein involved in outer membrane lipoprotein maturation. The enzyme catalyzes the N-acylation of apolipoproteins, a critical step in the biogenesis of bacterial outer membrane lipoproteins. In P. marinus strain MIT 9313, lnt is encoded by the gene PMT_0343 and functions with EC classification 2.3.1.- . Functionally, this enzyme plays a crucial role in the bacterial cell envelope structure, particularly in the proper assembly and anchoring of lipoproteins to the outer membrane. These lipoproteins are involved in many intercellular interactions and may influence how Prochlorococcus interacts with other marine bacteria such as Alteromonas species .

What is the structural composition of Prochlorococcus marinus lnt protein?

The Prochlorococcus marinus (strain MIT 9313) Apolipoprotein N-acyltransferase is a full-length protein consisting of 499 amino acids. The complete amino acid sequence begins with MGNDRSLALVQGAVGG and continues through to MLFA VVGLGLSRVRSWLISLMLC at the C-terminus . Structural analyses suggest it contains multiple transmembrane domains consistent with its function as an integral membrane protein. While no crystal structure specific to P. marinus lnt appears in the provided sources, comparative structural analysis with similar proteins from other cyanobacteria would likely reveal conserved catalytic domains characteristic of acyltransferases.

How does Prochlorococcus marinus fit into marine ecological systems?

Prochlorococcus marinus is the smallest known picocyanobacterium and a key photosynthetic organism in tropical and subtropical oligotrophic ocean regions. It comprises multiple distinct clades occupying various ecological niches, including Oxygen Minimum Zones (OMZ) . P. marinus MIT 9313 strain, which expresses the lnt protein under discussion, belongs to clade LLIV that falls near the base of the P. marinus radiation and is characterized by a preference for low light conditions typically found at depths of 120-200 meters . The LLIV clade, including MIT 9313, is currently the only cultured P. marinus strain found in Oxygen Minimum Zones, making it an important model for studying adaptations to low-oxygen marine environments .

What are the optimal storage and handling conditions for recombinant P. marinus lnt protein?

For optimal stability and activity, recombinant Prochlorococcus marinus Apolipoprotein N-acyltransferase should be stored at -20°C in a Tris-based buffer containing 50% glycerol. For extended storage periods, conservation at -80°C is recommended. It's crucial to avoid repeated freeze-thaw cycles which can significantly reduce protein activity and stability . When working with the protein, prepare small working aliquots that can be stored at 4°C for up to one week to minimize freeze-thaw damage. The protein appears to have relatively low thermostability compared to other proteins from photosynthetic organisms, so temperature control during experimental procedures is particularly important.

What expression systems are most effective for producing recombinant P. marinus lnt?

Based on research with similar proteins, E. coli-based expression systems appear to be effective for producing recombinant P. marinus proteins. When expressing membrane proteins like lnt, specialized E. coli strains designed for membrane protein expression (such as C41(DE3) or C43(DE3)) may yield better results than standard BL21(DE3) strains. Expression systems that allow for tight regulation of expression rates are advantageous since overexpression of membrane proteins can lead to toxicity and inclusion body formation.

For optimal expression:

  • Consider using a tag system (His-tag or other affinity tags) for easier purification

  • Optimize induction conditions (temperature, inducer concentration, induction time)

  • Supplement growth media with appropriate lipids that might facilitate proper folding

  • Use mild detergents during extraction and purification steps to maintain protein functionality

What assay systems can be used to measure P. marinus lnt enzymatic activity?

To assess the enzymatic activity of Prochlorococcus marinus Apolipoprotein N-acyltransferase, researchers can employ several complementary approaches:

  • In vitro acyltransferase assays: Using purified recombinant lnt protein with synthetic apolipoprotein substrates and radiolabeled or fluorescently labeled acyl donors. Product formation can be detected through thin-layer chromatography, HPLC, or mass spectrometry.

  • Complementation studies: Similar to approaches used with ferredoxin proteins, functional complementation in E. coli strains with defective lnt genes can demonstrate the activity of the P. marinus enzyme . Growth restoration in these systems provides evidence of functional activity.

  • Lipidomic analysis: Mass spectrometry-based lipidomic approaches can be used to detect changes in lipoprotein profiles when the enzyme is active versus when it is inhibited.

When conducting these assays, researchers should be mindful of the protein's probable low thermostability and optimize temperature conditions accordingly.

How do genomic variations in the lnt gene affect P. marinus adaptation to changing oceanic conditions?

Recent research has identified significant genomic variations in the promoter/5' region of the apolipoprotein N-acyltransferase gene in Prochlorococcus populations, particularly expansions of AT repeats . These variations appear to be influenced by environmental conditions, with significantly more polymorphisms observed in Prochlorococcus cultures evolved under elevated CO₂ conditions (800 ppm) compared to current atmospheric levels .

These findings suggest that the lnt gene may play a role in adaptation to changing oceanic conditions, particularly in response to ocean acidification. The modified expression of lnt could alter membrane lipoprotein composition, potentially influencing:

  • Cell membrane permeability and stability under changing pH conditions

  • Interactions with other marine microorganisms

  • Resistance to environmental stressors

To further investigate these adaptations, researchers should consider:

  • Comparative genomic analyses across P. marinus ecotypes from different ocean regions

  • Transcriptomic studies under varying CO₂ concentrations, temperatures, and light conditions

  • Experimental evolution studies combined with functional characterization of evolved lnt variants

What is the relationship between P. marinus lnt function and interactions with bacteriophages?

While the search results don't directly address bacteriophage interactions with lnt, they do indicate that Prochlorococcus interacts with marine phages that can influence host metabolism . The outer membrane modifications catalyzed by lnt might play a role in phage recognition and infection processes.

Research approaches to investigate this relationship could include:

  • Comparing lnt gene sequences and expression levels in phage-resistant versus phage-susceptible P. marinus strains

  • Analyzing whether phage infection alters lnt expression or activity

  • Determining if engineered modifications to lnt affect phage attachment or infection rates

  • Investigating whether any marine phages carry their own versions of lnt-like genes, as they do with other metabolic genes such as ferredoxin

The fact that phages encode their own electron transport proteins like ferredoxin suggests they may interact with or modify host membrane components to enhance viral fitness, potentially including lipoprotein structures modified by lnt .

How does P. marinus lnt function differ across various ecotypes and environmental conditions?

P. marinus exists as multiple ecotypes adapted to different light levels and oceanographic conditions, from high-light surface ecotypes to low-light deep-water variants like MIT 9313 . The function of lnt likely varies across these ecotypes due to:

  • Different membrane composition requirements at varying depths, temperatures, and oxygen levels

  • Variations in intercellular interactions with different microbial communities

  • Adaptations to light stress and oxidative damage protection

Comparative analysis of lnt sequences, expression patterns, and activity levels across ecotypes could provide insights into how this enzyme contributes to niche adaptation. The significant differences observed between high-light (HL) and low-light (LL) groups of P. marinus suggest that membrane proteins and their processing enzymes like lnt may have diverged functionally during the evolutionary radiation of this genus .

What role does lnt play in the adaptation of P. marinus to Oxygen Minimum Zones?

The MIT 9313 strain, which expresses the lnt protein under discussion, belongs to clade LLIV - one of the few Prochlorococcus strains found in Oxygen Minimum Zones (OMZs) where dissolved oxygen concentrations can be less than 20 μM . This raises important questions about how lnt function might contribute to survival in low-oxygen environments.

In OMZs, P. marinus may function as net oxygen consumers rather than producers , suggesting fundamental changes to their metabolism compared to surface populations. The lnt protein likely contributes to OMZ adaptation through:

  • Modifications to membrane lipoprotein composition that may enhance oxygen uptake or reduce oxygen permeability

  • Alterations in cell surface properties that affect interactions with other OMZ-adapted microorganisms

  • Changes to membrane protein anchoring that influence respiratory chain components

Research examining the expression and activity of lnt under varying oxygen concentrations, particularly in LLIV clade members compared to other ecotypes, could provide valuable insights into the molecular basis of OMZ adaptation in marine cyanobacteria.

How might mutations in the promoter region of the lnt gene influence P. marinus ecology?

Recent research has identified expansions of AT repeats in the promoter/5′ region of the apolipoprotein N-acyltransferase gene in Prochlorococcus populations, particularly under elevated CO₂ conditions . These genomic variations could significantly impact P. marinus ecology through:

  • Altered expression levels of lnt in response to environmental cues

  • Modified regulation patterns that affect membrane development during different growth phases

  • Changes in the timing of lipoprotein maturation that influence interactions with other marine microorganisms

The observation that these mutations are more prevalent under elevated CO₂ conditions suggests they may represent adaptations to future ocean acidification scenarios. This could influence community structure and biogeochemical cycling in marine ecosystems as climate change progresses.

What techniques can be used to study lnt-dependent protein-protein interactions in P. marinus?

To investigate protein-protein interactions involving Apolipoprotein N-acyltransferase in P. marinus, researchers can employ several complementary techniques:

TechniqueApplicationAdvantagesLimitations
Co-immunoprecipitationIdentification of stable protein complexesCan detect native interactionsRequires specific antibodies
Bacterial two-hybrid assaysScreening for direct interactionsCan be used for membrane proteinsMay produce false positives
Crosslinking mass spectrometryMapping interaction interfacesHigh resolution of interaction sitesComplex data analysis
Blue native PAGEAnalysis of intact membrane complexesPreserves functional complexesLimited resolution
Proximity labeling (BioID/APEX)Detecting transient interactionsWorks well with membrane proteinsPotential for non-specific labeling

When studying lnt interactions, researchers should focus on potential lipoprotein substrates, other membrane biogenesis proteins, and components of secretion pathways. The interactions between lnt and its target proteins are likely critical for understanding how P. marinus adapts its cell envelope structure to different environmental conditions.

How has the lnt gene evolved across the Prochlorococcus lineage?

The evolution of the lnt gene across the Prochlorococcus lineage likely reflects the diversification of this genus into multiple ecotypes. The Prochlorococcus radiation has produced distinct high-light (HL) and low-light (LL) adapted groups, with the LLIV clade (including MIT 9313) falling near the base of this radiation . Evolutionary analysis suggests that:

  • The core functions of lnt are likely conserved across all Prochlorococcus ecotypes due to its essential role in membrane biogenesis

  • Sequence divergence may reflect adaptations to different light regimes, depths, and oceanographic conditions

  • Regulatory regions of the gene appear particularly prone to mutation, as evidenced by AT repeat expansions

Comparative genomic analysis by Kettler et al. (2007) and Dufresne et al. (2008) indicated that many genes previously considered Prochlorococcus-specific actually contain sequences in HL and LL strains that are fairly distantly related to each other . This suggests potential functional divergence driven by adaptation to specific niches. The lnt gene may follow this pattern, with variants optimized for different membrane compositions required at different ocean depths.

What is the relationship between lipoproteins processed by lnt and intercellular interactions in marine ecosystems?

Lipoproteins processed by Apolipoprotein N-acyltransferase play important roles in intercellular interactions in bacterial systems. In P. marinus, these interactions may be particularly significant in:

  • Relationships with heterotrophic bacteria like Alteromonas, which have been shown to have complex interactions with Prochlorococcus

  • Potential interactions with secreted membrane vesicles in the marine environment

  • Recognition and infection dynamics with marine bacteriophages

The search results indicate that lipoproteins are involved in many intercell interactions in bacterial pathogens , and by extension, they likely mediate ecological relationships in marine microbial communities. The proper maturation of these lipoproteins, catalyzed by lnt, would therefore be critical for maintaining these relationships.

Research examining co-cultures of P. marinus with other marine bacteria, under conditions where lnt function is either enhanced or inhibited, could provide valuable insights into how this enzyme contributes to microbial community dynamics in oceanic systems.

How might climate change affect the function and expression of P. marinus lnt?

Climate change is expected to significantly alter oceanic conditions, including temperature, pH, oxygen levels, and stratification patterns. These changes may have profound effects on the function and expression of P. marinus lnt:

  • Ocean acidification: The observation of increased mutations in the lnt promoter region under elevated CO₂ conditions suggests that this gene is responsive to changes in ocean pH . Future research should investigate how these mutations affect lnt expression and functionality.

  • Expanding Oxygen Minimum Zones: As OMZs expand due to warming and increased stratification, P. marinus ecotypes adapted to these conditions (like MIT 9313) may become more prevalent . Understanding lnt function in these strains could help predict ecosystem responses.

  • Poleward range expansion: Ocean warming may allow P. marinus to expand into new geographic regions , potentially requiring adaptations in membrane composition and lipoprotein processing.

Experimental evolution studies under simulated future ocean conditions, combined with functional characterization of evolved lnt variants, could provide valuable insights into potential adaptive responses.

What biotechnological applications might emerge from research on P. marinus lnt?

While the search results don't directly address biotechnological applications of P. marinus lnt, several potential applications can be inferred:

  • Biosensors: Engineered lipoproteins processed by lnt could potentially be developed into biosensors for marine environmental monitoring.

  • Protein engineering: Understanding the mechanisms of lipoprotein anchoring in extremophilic marine bacteria could inform the design of stabilized proteins for industrial applications.

  • Synthetic biology: The minimal genome of Prochlorococcus makes it an interesting candidate for synthetic biology applications, and understanding lnt function is critical for engineering its membrane systems.

  • Biofuel applications: As researchers explore marine cyanobacteria for biofuel production, understanding membrane biogenesis proteins like lnt will be important for optimizing these systems.

How does the study of lnt contribute to our understanding of minimal genomes in marine cyanobacteria?

Prochlorococcus marinus is known for having one of the smallest genomes among free-living photosynthetic organisms, reflecting a pattern of genome streamlining adapted to oligotrophic ocean environments . The retention of lnt in this minimal genome underscores its essential nature in cellular function.

Studying lnt in the context of Prochlorococcus genome evolution provides insights into:

  • Core functions that cannot be eliminated even in highly streamlined genomes

  • Adaptations that allow maintenance of essential cellular processes with minimal genetic material

  • The evolution of membrane biogenesis systems in photosynthetic organisms

Comparing lnt function across Prochlorococcus and other cyanobacteria with larger genomes could reveal how essential cellular processes are maintained with minimal genetic information, contributing to our fundamental understanding of the limits of life and cellular complexity.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.