Recombinant Prochlorococcus marinus ATP synthase subunit a (atpB)

Shipped with Ice Packs
In Stock

Description

2.1. Functional Studies in Microbial Physiology

  • Glucose Transport Mechanisms: Recombinant atpB has been used to study energy-coupled transport systems. For instance, Prochlorococcus strains expressing atpB homologs demonstrated glucose uptake via the Pro1404 transporter when expressed in Synechococcus elongatus .

  • DNA Replication Adaptations: In high-light-adapted P. marinus strains, ATP synthase genes co-localize with recombinase RecA, suggesting evolutionary optimization for UV-damage repair. Recombinant ATP synthase proteins (e.g., AD-Lig P) show 10x higher activity in sealing nicked DNA compared to low-light ecotypes .

2.2. Environmental Adaptation

  • Nutrient Uptake in Oligotrophic Oceans: ATP synthase in high-light ecotypes is linked to ABC transporters that enhance nutrient scavenging in nutrient-poor surface waters. These strains exhibit genomic adaptations, including truncated NAD-dependent ligases replaced by ATP-dependent variants .

  • Ecotype-Specific Gene Content: Bi-clustering of 40 P. marinus genomes revealed differential ATP synthase gene expression between high-light (HL) and low-light (LL) strains, correlating with photic zone niche specialization .

Strain-Specific Variations

StrainEcotypeGenomic ContextNotable Features
MIT9301HLCo-located with RecA recombinaseEnhanced DNA repair efficiency
SS120 (MED4)LLFull-length NAD-ligase genesCanonical ATP synthase function
NATL2AHLTruncated ND-ligases, multiple AD-ligasesOptimized for high UV and low nutrients

Technical Considerations for Experimental Use

  • Reconstitution: Requires solubilization in Tris/PBS buffer with 6% trehalose (pH 8.0). Glycerol (5–50%) is recommended for long-term storage .

  • Activity Assays: Functional validation typically uses urea PAGE gels to assess ligase activity, with preference for Mg²⁺ as a cofactor .

Evolutionary and Ecological Insights

  • Genome Minimization: P. marinus has the smallest genome among free-living prokaryotes (~1.6–1.75 Mb), yet retains ATP synthase genes critical for energy metabolism .

  • Horizontal Gene Transfer: Homologous recombination events in core genomes, including ATP synthase loci, highlight adaptive responses to oxidative stress and nutrient limitations .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag, please inform us, and we will prioritize its implementation.
Synonyms
atpB; atpI; PMT9312_1549; ATP synthase subunit a; ATP synthase F0 sector subunit a; F-ATPase subunit 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-241
Protein Length
full length protein
Species
Prochlorococcus marinus (strain MIT 9312)
Target Names
atpB
Target Protein Sequence
MLFNSLLTNFAALEVGQHLYWQIGNIRLHGQVFLTSWILLGALLVFISLGTKKMENDPKG LQNLLEFLWDYIRDLARTQIGEKVYRDWMPFIGTLFLFVFVSNWGGALIPWRLIKLPSGE LGAPTADINTTIALALLVSLSYFYAGLSNKGWRYFEYYVHPTPIMLPFKILEDFTKPLSL SFRLFGNILADELVVGVLVFLVPLILPIPVMFLGLFTSAIQALIFATLAAYYIGEAVEEH H
Uniprot No.

Target Background

Function
A key component of the proton channel, directly involved in proton translocation across the membrane.
Database Links
Protein Families
ATPase A chain family
Subcellular Location
Cellular thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the role of ATP synthase subunit a (atpB) in Prochlorococcus marinus?

ATP synthase subunit a (atpB) in Prochlorococcus marinus is a critical component of the F₀F₁-ATP synthase complex, which is responsible for ATP production through oxidative phosphorylation. The a-subunit contains two half-channels, each exposed to opposite sides of the membrane. During ATP synthesis, protons from the periplasmic space enter through one half-channel, are transferred to the c-ring, and after one revolution, are released into the cytoplasmic solution via the opposite half-channel . This proton translocation drives the rotation of the c-ring, which in turn drives the conformational changes in F₁ that lead to ATP synthesis. The a-subunit thus plays a crucial role in coupling proton movement to the rotational catalysis of ATP synthesis.

What expression systems are optimal for recombinant Prochlorococcus marinus atpB production?

For recombinant production of Prochlorococcus marinus atpB, E. coli has proven to be an effective heterologous expression system . When designing an expression strategy, researchers should consider:

  • Codon optimization: Adapting the Prochlorococcus codon usage to E. coli is critical for efficient translation

  • Vector selection: pET-based vectors with T7 promoters allow for controlled, high-level expression

  • Fusion tags: N-terminal His-tags facilitate purification while minimizing interference with protein function

  • Expression conditions: Lower temperatures (16-20°C) after induction help prevent inclusion body formation

  • Host strain selection: E. coli strains like BL21(DE3) or C41(DE3), which are designed for membrane protein expression, yield better results

The addition of detergents during cell lysis is essential for solubilizing this membrane protein. A comparison of different expression conditions shows that induction at OD₆₀₀ of 0.6-0.8 with 0.1-0.5 mM IPTG, followed by expression at 18°C for 16-20 hours, typically yields the highest amount of properly folded protein.

What purification protocol yields the highest purity and activity for recombinant atpB?

A multi-step purification protocol is recommended for recombinant Prochlorococcus marinus atpB:

  • Initial solubilization: Use mild detergents like n-dodecyl-β-D-maltoside (DDM) or digitonin to solubilize membrane fractions

  • IMAC purification: Utilize the His-tag for initial purification on Ni-NTA resin

  • Size exclusion chromatography: Further purify using gel filtration to separate monomeric from aggregated protein

  • Detergent exchange: If necessary for downstream applications, exchange to a different detergent during gel filtration

  • Quality control: Verify purity by SDS-PAGE (>90% purity is achievable)

For long-term storage, the addition of 6% trehalose helps maintain protein stability during freeze-thaw cycles . Avoid repeated freeze-thaw cycles, and store working aliquots at 4°C for up to one week. For reconstitution, use deionized sterile water to achieve a concentration of 0.1-1.0 mg/mL, and add 5-50% glycerol for long-term storage at -20°C/-80°C .

What techniques are most effective for analyzing the structure-function relationship of recombinant atpB?

To investigate structure-function relationships of recombinant Prochlorococcus marinus atpB, researchers can employ several complementary approaches:

  • Site-directed mutagenesis: Target conserved residues in the proton-conducting channels to assess their role in function

  • Reconstitution into liposomes: Measure proton pumping activity using pH-sensitive fluorescent dyes

  • Electron microscopy: Cryo-EM can provide structural insights, particularly when atpB is assembled with other ATP synthase components

  • Hydrogen-deuterium exchange mass spectrometry: Map solvent-accessible regions and conformational changes

  • Molecular dynamics simulations: Model proton movement through the half-channels based on structural data

When designing mutagenesis studies, researchers should focus on the highly conserved arginine residues in the transmembrane domains, which are critical for proton translocation. Functional assays should measure ATP synthesis rates under varying proton motive force conditions.

How can researchers assess the proton translocation efficiency of recombinant atpB?

Assessing proton translocation efficiency requires specialized techniques:

  • Proteoliposome reconstitution: Incorporate purified atpB (ideally with the complete ATP synthase complex) into liposomes

  • Establishment of proton gradient: Create an artificial proton gradient across the liposome membrane

  • Measurement methods:

    • pH-sensitive fluorescent probes (e.g., ACMA or pyranine)

    • Patch-clamp electrophysiology for direct current measurements

    • Radiolabeled proton flux assays using tritiated water

For quantitative analysis, researchers can calculate the H⁺/ATP ratio, which indicates how many protons must be translocated to synthesize one ATP molecule. Recent research on F₀F₁-ATP synthase shows that this ratio varies among species, ranging from 2.7 to 5, depending on the number of c-subunits in the rotor ring . Engineering approaches have achieved ratios as high as 5.9, enabling ATP synthesis at lower proton motive force values .

How does atpB function contribute to Prochlorococcus adaptation to oligotrophic environments?

Prochlorococcus has evolved to thrive in nutrient-limited oligotrophic oceans through genome streamlining and metabolic adaptations. The ATP synthase complex, including atpB, plays a crucial role in this adaptation:

  • Energy efficiency: Optimized proton-to-ATP conversion allows Prochlorococcus to maximize energy capture from limited resources

  • Response to nitrogen limitation: Under nitrogen starvation conditions, Prochlorococcus undergoes extensive proteome remodeling, with photosynthetic proteins and ATP synthase components being differentially regulated

  • Integration with carbon metabolism: Recent research has shown that Prochlorococcus can take up glucose via the Pro1404 transporter , suggesting a more flexible metabolic strategy than previously thought

Under extreme nitrogen limitation, Prochlorococcus responds by slowing down translation while inducing photosynthetic cyclic electron flow . This adaptation likely involves modulation of ATP synthase activity to maintain energy balance while conserving nitrogen resources.

How does atpB expression change in response to environmental stressors?

Prochlorococcus modulates atpB expression in response to various environmental stressors:

  • Nitrogen limitation: Proteomics studies have shown that extreme nitrogen starvation (simulated by azaserine treatment) results in significant proteome remodeling, with the majority of proteins (92.4%) being downregulated after 8 hours of treatment

  • Light stress: Transcriptome analysis has revealed that co-culture with heterotrophic bacteria reduces stress conditions for Prochlorococcus, as indicated by decreased expression of DNA repair enzymes and stress-response proteins

  • Co-culture effects: The presence of heterotrophic bacteria like Alteromonas macleodii affects a stable shift in Prochlorococcus physiology, including changes in photosynthetic apparatus components and biosynthetic enzymes

These adaptive responses highlight the importance of ATP synthase regulation in maintaining cellular energy balance under varying environmental conditions.

How does Prochlorococcus marinus atpB differ from ATP synthase components in other photosynthetic organisms?

Comparative analysis reveals several key differences between Prochlorococcus marinus atpB and its counterparts in other photosynthetic organisms:

Evolutionary analysis suggests that Prochlorococcus has optimized its ATP synthase for function in the relatively stable temperature and pH conditions of open ocean environments, potentially sacrificing adaptability for efficiency.

What can atpB sequence variations tell us about Prochlorococcus ecotype specialization?

Sequence variations in atpB can provide insights into Prochlorococcus ecotype specialization:

  • High-light vs. low-light adapted strains: Comparative genomics can reveal adaptations in atpB that may reflect different energy management strategies

  • Thermal adaptations: Variations in hydrophobic regions may indicate adaptations to different temperature ranges

  • Proton channel modifications: Subtle changes in the proton-conducting channels might affect the efficiency of ATP synthesis under different environmental conditions

Researchers should apply phylogenetic analysis to atpB sequences from different Prochlorococcus ecotypes to identify signature mutations that correlate with environmental niches.

How can recombinant atpB be used to study ATP synthase assembly and function?

Recombinant Prochlorococcus marinus atpB can serve as a valuable tool for studying ATP synthase assembly and function:

  • Co-expression systems: Expression of atpB alongside other ATP synthase components to study complex assembly

  • Hybrid complexes: Creation of chimeric ATP synthases with components from different organisms to investigate compatibility and functional conservation

  • Single-molecule studies: Using labeled recombinant atpB to track rotational dynamics during ATP synthesis

  • Structural biology: Providing material for high-resolution structural studies using cryo-EM or X-ray crystallography

These approaches can yield insights into the fundamental mechanisms of ATP synthesis and the specific adaptations in Prochlorococcus that contribute to its ecological success.

What implications does atpB research have for understanding global carbon and energy cycles?

Research on Prochlorococcus marinus atpB has broader implications:

  • Global carbon fixation: As the most abundant photosynthetic organism on Earth, Prochlorococcus contributes significantly to global primary production

  • Ocean ecosystem dynamics: Understanding how Prochlorococcus manages energy conversion helps explain its dominance in oligotrophic oceans

  • Climate change impacts: Research on how ATP synthase function responds to changing ocean conditions (temperature, pH) can inform predictions about future ocean productivity

  • Bioenergetic principles: The study of natural variations in H⁺/ATP ratios provides insights into fundamental energy conversion mechanisms

Recent engineering efforts to enhance the H⁺/ATP ratio beyond what is found in nature (achieving ratios of 5.9) demonstrate the potential for applying these insights to design more efficient bioenergetic systems .

What are common challenges in expressing and purifying functional recombinant atpB?

Researchers often encounter several challenges when working with recombinant Prochlorococcus marinus atpB:

  • Low expression yields: As a membrane protein, atpB often expresses poorly in heterologous systems

    • Solution: Optimize codon usage, use specialized expression strains, and test different induction conditions

  • Protein aggregation: Hydrophobic membrane proteins tend to aggregate when overexpressed

    • Solution: Express at lower temperatures (16-18°C), use solubilization tags, and optimize detergent selection

  • Loss of native conformation: Detergent solubilization may disrupt protein structure

    • Solution: Screen multiple detergents (DDM, digitonin, LMNG) for optimal solubilization while maintaining function

  • Stability issues: Purified atpB may degrade rapidly

    • Solution: Add stabilizing agents like trehalose (6%) , avoid repeated freeze-thaw cycles, and store at appropriate temperatures

  • Functional assays: Demonstrating activity of isolated atpB is challenging

    • Solution: Co-reconstitute with other ATP synthase components or develop targeted assays for specific functions

How can researchers verify the structural integrity and functionality of purified recombinant atpB?

Verification of structural integrity and functionality requires multiple complementary approaches:

For all applications, it's recommended to use freshly prepared protein when possible, reconstituting lyophilized protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL, and adding 5-50% glycerol for long-term storage .

What emerging technologies could advance our understanding of atpB function in Prochlorococcus?

Several emerging technologies show promise for advancing atpB research:

  • Cryo-electron tomography: Visualizing ATP synthase in its native membrane environment

  • Single-molecule FRET: Tracking conformational changes during the catalytic cycle

  • Mass photometry: Analyzing subunit stoichiometry and complex assembly in near-native conditions

  • CRISPR-based genome editing: Creating targeted mutations in Prochlorococcus to study atpB function in vivo

  • Artificial intelligence approaches: Using machine learning to predict structure-function relationships and design functional variants

The integration of these technologies with systems biology approaches will provide a more comprehensive understanding of how atpB contributes to Prochlorococcus energy metabolism and ecological success.

How might research on Prochlorococcus atpB contribute to biotechnological applications?

Research on Prochlorococcus marinus atpB has several potential biotechnological applications:

  • Bioenergetic engineering: The principles learned from natural ATP synthases can inform the design of enhanced energy conversion systems, as demonstrated by recent engineering efforts to increase the H⁺/ATP ratio

  • Synthetic biology: Incorporating modified ATP synthases into synthetic cells or organelles

  • Biofuel production: Improving energy efficiency in photosynthetic microorganisms used for biofuel production

  • Environmental monitoring: Developing biosensors based on ATP synthase components that respond to changes in environmental conditions

  • Structural biology platforms: Using atpB as a model for developing improved methods for membrane protein expression and analysis

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.