Recombinant Prochlorococcus marinus ATP synthase subunit b (atpF)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder

Note: We will prioritize shipping the format currently in stock. If you require a specific format, please specify this during order placement.

Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.

Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.

Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.

Tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.

Synonyms
atpF; PMT9312_1546; ATP synthase subunit b; ATP synthase F(0 sector subunit b; ATPase subunit I; F-type ATPase subunit b; F-ATPase subunit b
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-170
Protein Length
full length protein
Species
Prochlorococcus marinus (strain MIT 9312)
Target Names
atpF
Target Protein Sequence
MNLTLLATEGFGLNFNLFETNILNWAVVVFGLYKFLPSFLGKMLQKRREGILLELKDAED RLVNATKALDKAKKDLSSAEEKASQIKADSFKRSESIRMESEKKAIEEMARIKQSAISDE SSEASRAISQLRKEAVELAIKKALDSLPNRLDSTTQENLVTQSINNIEVN
Uniprot No.

Target Background

Function

F(1)F(0) ATP synthase synthesizes ATP from ADP using a proton or sodium gradient. F-type ATPases comprise two domains: the F(1) catalytic core (extramembraneous) and the F(0) membrane proton channel. These domains are connected by a central and peripheral stalk. ATP synthesis within the F(1) catalytic domain is coupled, via a rotary mechanism of the central stalk subunits, to proton translocation. This protein is a component of the F(0) channel, forming part of the peripheral stalk and linking F(1) to F(0).

Database Links
Protein Families
ATPase B chain family
Subcellular Location
Cellular thylakoid membrane; Single-pass membrane protein.

Q&A

What are the optimal storage conditions for recombinant Prochlorococcus marinus atpF protein?

For optimal stability and activity retention, recombinant Prochlorococcus marinus atpF protein should be stored as follows:

  • Long-term storage: The lyophilized protein should be stored at -20°C to -80°C upon receipt.

  • Working solutions: After reconstitution, store at 4°C for up to one week.

  • For extended storage of reconstituted protein: Add glycerol to a final concentration of 5-50% (recommended: 50%) and store in small aliquots at -20°C to -80°C.

Repeated freeze-thaw cycles significantly reduce protein activity and should be strictly avoided. The recommended reconstitution procedure involves brief centrifugation of the vial prior to opening, followed by reconstitution in deionized sterile water to a concentration of 0.1-1.0 mg/mL using a Tris/PBS-based buffer (pH 8.0) containing 6% trehalose .

How does Prochlorococcus marinus adapt to nitrogen limitation, and what role might ATP synthase play?

Prochlorococcus marinus exhibits complex adaptive responses to nitrogen limitation, a common stress factor in oligotrophic ocean environments. Proteomic analysis of P. marinus SS120 under azaserine treatment (which simulates extreme nitrogen starvation by inhibiting glutamate synthase) reveals a comprehensive cellular response:

  • Translation machinery downregulation: 92.4% of significantly changed proteins are downregulated after 8 hours of treatment, particularly ribosomal proteins.

  • Enhanced transport mechanisms: Many transporter proteins show increased expression to maximize nutrient uptake efficiency.

  • Metabolic reprogramming: The organism responds by slowing down translation processes while simultaneously inducing photosynthetic cyclic electron flow.

  • Regulatory changes: Key nitrogen regulatory proteins (PII and PipX) decrease while the global nitrogen regulator NtcA increases .

ATP synthase, as a critical component of energy metabolism, likely supports these adaptations by maintaining ATP homeostasis during stress conditions, though its specific regulation under nitrogen limitation requires further investigation.

What are the most effective experimental approaches for studying recombinant Prochlorococcus marinus atpF protein function in relation to oceanic adaptation?

Investigating the function of Prochlorococcus marinus atpF protein in relation to oceanic adaptation requires a multi-faceted experimental approach:

Primary analytical techniques:

  • Comparative genomic analysis: Compare atpF sequences across Prochlorococcus ecotypes from different ocean depths and geographical locations to identify adaptive variations. Use frameworks similar to those employed in nitrogen assimilation studies, analyzing r/m values (ratio of nucleotide changes due to recombination relative to point mutation) to assess evolutionary pressures .

  • Structural-functional analysis: Use site-directed mutagenesis to modify key residues, followed by ATP synthesis/hydrolysis assays to correlate structural features with function under varying physiological conditions (pH, salinity, temperature gradients).

  • In vivo imaging: Apply fluorescent ATP sensors such as iATPSnFR2 (ΔF/F ~12) to track ATP dynamics in living cells expressing native versus mutant atpF variants, allowing real-time visualization of energetic responses to environmental stressors .

  • Proteomics integration: Combine targeted atpF studies with whole-proteome analysis to contextualize findings within the broader adaptive response network, similar to approaches used in nitrogen limitation studies .

Experimental design considerations:

ParameterOptimal ConditionRationale
Expression systemMarine cyanobacteria (if possible) or E. coliNative environment provides relevant post-translational modifications
Purification methodNickel affinity chromatographyHis-tagged construct allows high purity isolation
Functional assayspH range 7.5-8.3, 20-28°CMimics oceanic conditions where Prochlorococcus thrives
ATP synthesis measurementLuciferase-based assays or iATPSnFR2 sensorsProvides high sensitivity detection of ATP production

This comprehensive approach yields insights into both mechanistic function and evolutionary adaptation of atpF in Prochlorococcus marinus strains across oceanic niches.

How does homologous recombination influence the evolution of ATP synthase genes in Prochlorococcus populations, and what are the methodological approaches for studying this phenomenon?

Homologous recombination significantly shapes the evolution of functional genes in Prochlorococcus, including those encoding ATP synthase components. Based on studies of nitrogen assimilation genes, we can infer similar evolutionary dynamics for ATP synthase genes:

Key evolutionary mechanisms:

  • Homologous recombination rates for core metabolic genes in Prochlorococcus typically exceed mutation rates, with r/m values (recombination to mutation ratio) well above 1, indicating recombination is a dominant evolutionary force .

  • Vertical inheritance, gene loss, and homologous recombination appear to govern gene distribution within clades, rather than horizontal gene transfer from distant taxa .

Methodological approaches for studying recombination in atpF genes:

  • Population genomic analysis:

    • Compare atpF sequences from geographically distinct populations

    • Calculate fixation indices (FST) to quantify genetic differentiation

    • Apply ClonalFrameML or similar tools to estimate recombination parameters

  • Phylogenetic incongruence testing:

    • Construct phylogenies using atpF and multiple core housekeeping genes

    • Identify topological conflicts indicative of recombination events

    • Statistically test for significant phylogenetic divergence between populations

  • Experimental verification:

    • PCR screening of single-cell genomes using degenerate primers targeting conserved regions

    • Design primers with moderate degeneracy (30-64 fold) targeting conserved protein motifs

    • Employ real-time PCR with melting curve analysis for verification

When applying these methodologies to ATP synthase genes, researchers should implement similar approaches to those used for nitrogen assimilation genes, including alignment by codon and careful primer design targeting conserved motifs across Prochlorococcus and marine Synechococcus genomes.

How can single-cell techniques be optimized for studying ATP synthase function in Prochlorococcus marinus?

Single-cell approaches offer powerful insights into ATP synthase function in Prochlorococcus marinus, particularly given the significant genomic diversity within natural populations. Building on methodologies described for nitrogen assimilation studies, researchers can adopt these approaches:

Single-cell genome recovery and analysis:

  • Optimized cell isolation:

    • Flow cytometry sorting based on chlorophyll fluorescence and forward scatter

    • Microfluidic droplet encapsulation to minimize contamination

    • Careful quality control with chlorophyll autofluorescence verification

  • Genome amplification and quality assessment:

    • Multiple displacement amplification (MDA) with phi29 polymerase

    • Rigorous quality filtering (exclude cells with <25% genome recovery)

    • Apply checkM or similar tools to assess completeness

  • Target gene verification:

    • Design degenerate primers targeting conserved regions of atpF

    • Develop PCR screening assays similar to those used for narB detection

    • Implement melting curve analysis for verification of correct amplicons

Single-cell functional analysis:

  • ATP dynamics monitoring:

    • Employ genetically encoded ATP sensors (e.g., iATPSnFR2) with high dynamic range (ΔF/F ~12)

    • Use ratiometric measurements with spectrally separable fluorescent tags

    • Normalize signals to expression levels for quantitative comparisons

  • Subcellular resolution approach:

    • Target ATP sensors to different cellular compartments

    • Monitor ATP dynamics during metabolic perturbations at both whole-cell and subcellular levels

    • Compare responses across single cells from different ecotypes

  • Integration with transcriptomics:

    • Combine with single-cell RNA-seq to correlate ATP synthase gene expression with function

    • Implement split-pool ligation-based transcriptome sequencing (SPLiT-seq) for high-throughput analysis

This comprehensive single-cell approach provides unprecedented insights into the heterogeneity of ATP synthase function within Prochlorococcus populations, revealing cell-to-cell variations that would be masked in bulk analyses.

What quality control measures are essential when working with recombinant Prochlorococcus marinus atpF protein?

Rigorous quality control is critical when working with recombinant Prochlorococcus marinus atpF protein to ensure experimental reliability. Implement these essential quality control measures:

Protein purity assessment:

  • SDS-PAGE analysis:

    • Target purity should exceed 90% as determined by densitometry

    • Run alongside appropriate molecular weight markers (expected MW: ~18-20 kDa plus tag)

    • Visualize with Coomassie blue staining for quantitative assessment

  • Western blot verification:

    • Use anti-His antibodies to confirm tag presence

    • Consider developing custom antibodies against atpF for specificity

    • Assess for degradation products or aggregates

Functional verification:

  • ATP binding assay:

    • Measure intrinsic tryptophan fluorescence changes upon nucleotide binding

    • Determine binding affinity (Kd) and compare to literature values

    • Assess both ATP and ADP binding characteristics

  • Structural integrity:

    • Circular dichroism spectroscopy to confirm secondary structure elements

    • Thermal shift assays to determine stability under experimental conditions

    • Limited proteolysis to verify proper folding

Long-term stability monitoring:

  • Storage stability verification:

    • Test activity retention after storage at recommended conditions

    • Compare fresh vs. stored protein in functional assays

    • Implement accelerated stability testing protocols

  • Batch consistency verification:

    • Maintain reference standards from validated batches

    • Compare new preparations to references in activity and purity assays

    • Document lot-to-lot variations with certificate of analysis

By implementing these quality control measures, researchers can ensure that experimental observations reflect the native properties of atpF rather than artifacts of preparation or storage conditions .

How can researchers effectively design experiments to investigate ATP synthase adaptation across different Prochlorococcus ecotypes?

Designing experiments to investigate ATP synthase adaptation across Prochlorococcus ecotypes requires careful consideration of evolutionary, environmental, and functional factors. The following framework provides a comprehensive approach:

Comparative genomic foundation:

  • Ecotype selection strategy:

    • Include representatives from high-light (HL) and low-light (LL) adapted clades

    • Select strains from varied geographical locations and ocean depths

    • Incorporate recently identified ecotypes (e.g., HLIII, HLIV)

  • Targeted gene analysis:

    • Compare atpF and other ATP synthase genes across all selected ecotypes

    • Calculate selection parameters (dN/dS) to identify regions under selection

    • Apply codon-by-codon analysis to locate specific adaptive sites

Environmental correlation approach:

  • Growth characterization matrix:

EcotypeOptimal Light (μmol photons m⁻² s⁻¹)Optimal Temperature (°C)ATP Synthase Activity (nmol ATP mg⁻¹ protein min⁻¹)
HLI150-20022-25[Measured value]
HLII150-20025-28[Measured value]
LLI30-6018-22[Measured value]
LLIV10-3015-18[Measured value]
  • Gradient response testing:

    • Expose ecotypes to light, temperature, and nutrient gradients

    • Measure ATP synthase activity, ATP/ADP ratios, and growth rates

    • Correlate genotypic differences with phenotypic responses

Functional variation characterization:

  • Biochemical parameter comparison:

    • Determine pH optima for each ecotype's ATP synthase

    • Measure kinetic parameters (Km, Vmax) under varied conditions

    • Assess inhibitor sensitivity profiles

  • Hybrid enzyme construction:

    • Create chimeric ATP synthase complexes with subunits from different ecotypes

    • Map functional differences to specific protein regions

    • Validate with site-directed mutagenesis of identified sites

This integrated approach allows researchers to connect genomic adaptations in ATP synthase genes with functional differences and ecological niches, providing insights into how this essential enzyme complex has evolved across Prochlorococcus ecotypes.

What approaches can resolve inconsistent activity of recombinant Prochlorococcus marinus atpF protein in experimental assays?

Inconsistent activity of recombinant Prochlorococcus marinus atpF protein can significantly impair research progress. This comprehensive troubleshooting guide addresses common sources of variability and their solutions:

Expression and purification optimization:

  • Expression system evaluation:

    • Compare E. coli strains (BL21, C41, C43, Rosetta) for optimal expression

    • Test autoinduction versus IPTG induction protocols

    • Optimize temperature and duration of induction (lower temperatures often improve folding)

  • Purification refinement:

    • Implement multi-step purification (IMAC followed by size exclusion chromatography)

    • Test different buffer compositions to enhance stability

    • Consider native purification conditions versus denaturing/refolding approaches

Activity preservation strategies:

  • Buffer optimization matrix:

ComponentRange to TestFunction
pH7.0-8.5Maintains protein charge distribution
NaCl50-300 mMProvides ionic strength for stability
Glycerol5-20%Prevents aggregation and freezing damage
Reducing agent0.1-5 mM DTT or TCEPMaintains thiol groups
StabilizersTrehalose (2-10%)Preserves structure during freeze/thaw
  • Storage protocol refinement:

    • Compare flash-freezing versus slow freezing protocols

    • Test small aliquot storage to minimize freeze-thaw cycles

    • Evaluate lyophilization with different excipients

Assay optimization approaches:

  • Reaction conditions:

    • Systematically vary temperature (15-30°C), pH (6.5-8.5), and salt concentration

    • Test different divalent cations (Mg²⁺, Mn²⁺, Ca²⁺) as cofactors

    • Optimize ATP concentration based on Km determination

  • Assay technology selection:

    • Compare direct (HPLC, NMR) versus coupled enzyme assays

    • Consider luminescence-based ATP detection for higher sensitivity

    • Implement real-time monitoring using fluorescent ATP sensors

  • Protein quality verification:

    • Implement thermal shift assays before each experimental series

    • Use dynamic light scattering to detect aggregation

    • Verify proper folding via circular dichroism or limited proteolysis

By systematically addressing these potential sources of variability, researchers can establish reproducible conditions for studying recombinant Prochlorococcus marinus atpF protein, ensuring consistent activity across experiments.

How can researchers distinguish between ATP synthase isoforms and homologs when studying Prochlorococcus marinus genomic and metagenomic datasets?

Accurately distinguishing ATP synthase isoforms and homologs in Prochlorococcus marinus genomic and metagenomic datasets presents significant challenges. Implementing these systematic approaches helps ensure precise identification and characterization:

Bioinformatic discrimination strategies:

  • Sequence-based approaches:

    • Implement position-specific scoring matrices (PSSMs) derived from verified atpF sequences

    • Apply hidden Markov models (HMMs) trained on cyanobacterial ATP synthase components

    • Utilize multiple sequence alignment with known reference sequences, analyzing conserved motifs

  • Genomic context analysis:

    • Examine operon structure and gene neighborhood

    • Verify presence of other ATP synthase components (atpA, atpB, etc.) in proximity

    • Compare synteny across reference genomes

Phylogenetic resolution methods:

  • Multi-locus phylogenetic reconstruction:

    • Build trees using concatenated ATP synthase subunits

    • Compare with core genome phylogeny to identify horizontal gene transfer events

    • Apply reconciliation methods to distinguish orthology from paralogy

  • Recombination detection:

    • Calculate r/m values across ATP synthase genes to quantify recombination influence

    • Apply methods like ClonalFrameML to identify recombination breakpoints

    • Assess the impact of recombination on phylogenetic inference

Experimental validation approaches:

  • PCR-based verification:

    • Design degenerate primers targeting conserved regions of different isoforms

    • Implement mismatch amplification mutation assays (MAMA-PCR) for isoform-specific detection

    • Verify amplicons by sequencing or high-resolution melting analysis

  • Expression pattern analysis:

    • Examine transcriptomic data for differential expression of isoforms

    • Correlate expression with environmental parameters

    • Validate with RT-qPCR using isoform-specific primers

Decision algorithm for isoform classification:

  • First-level filter: Sequence similarity to reference atpF (>70% identity)

  • Second-level filter: Presence of conserved functional motifs

  • Third-level filter: Phylogenetic clustering with known isoforms

  • Fourth-level filter: Genomic context consistency

  • Final verification: Experimental validation where possible

This comprehensive approach enables accurate discrimination between genuine atpF isoforms and related homologs, providing a solid foundation for functional and evolutionary studies of ATP synthase in Prochlorococcus marinus.

What emerging technologies might advance our understanding of ATP synthase regulation in Prochlorococcus marinus under changing ocean conditions?

Several cutting-edge technologies show exceptional promise for advancing our understanding of ATP synthase regulation in Prochlorococcus marinus as ocean conditions change:

Advanced imaging technologies:

  • Cryo-electron tomography:

    • Visualize ATP synthase organization in intact Prochlorococcus cells

    • Examine structural adaptations across ecotypes from different ocean regions

    • Track conformational changes under simulated climate change conditions

  • Advanced fluorescent biosensors:

    • Deploy next-generation ATP sensors like iATPSnFR2 with high dynamic range (ΔF/F ~12)

    • Use ratiometric measurements with spectrally separable fluorescent tags for quantitative comparisons

    • Target sensors to specific subcellular compartments to monitor localized ATP dynamics

Single-cell technologies:

  • Multi-omics integration:

    • Combine single-cell genomics, transcriptomics, and proteomics

    • Correlate ATP synthase gene variants with expression levels and protein abundance

    • Identify regulatory networks controlling ATP synthase expression

  • Microfluidic approaches:

    • Create artificial ocean microenvironments with controlled gradients

    • Track single-cell responses to changing conditions in real-time

    • Isolate individual cells for downstream genomic and biochemical analysis

CRISPR-based technologies:

  • In situ genome editing:

    • Develop CRISPR systems optimized for marine cyanobacteria

    • Create precise mutations in ATP synthase genes to test functional hypotheses

    • Engineer reporter strains for monitoring ATP synthase regulation

  • CRISPRi transcriptional regulation studies:

    • Deploy inducible CRISPRi to modulate ATP synthase gene expression

    • Examine effects on growth, photosynthesis, and stress responses

    • Map regulatory networks controlling ATP homeostasis

Climate change simulation platforms:

ParameterCurrent TechnologyEmerging Solution
TemperatureFixed incubatorsProgrammable gradient systems with diel fluctuations
CO₂/pHBatch acidificationContinuous CO₂ control with natural variability patterns
Nutrient dynamicsStatic mediaAutomated microfluidic nutrient pulsing systems
Multi-stressor integrationSequential testingFactorial design with AI-optimized parameter combinations

These emerging technologies, particularly when integrated, offer unprecedented opportunities to understand how ATP synthase regulation in Prochlorococcus marinus responds to changing ocean conditions, providing critical insights for predicting impacts on marine primary productivity and carbon cycling in future oceans.

How might the structure-function relationship of ATP synthase in Prochlorococcus marinus inform biotechnological applications?

The unique structure-function characteristics of ATP synthase from Prochlorococcus marinus offer significant potential for innovative biotechnological applications, leveraging adaptations evolved for survival in challenging oligotrophic environments:

Bioenergy applications:

  • Enhanced photosynthetic efficiency:

    • Engineer ATP synthase variants from high-light adapted ecotypes into biofuel-producing organisms

    • Optimize proton coupling efficiency for improved energy conversion

    • Create chimeric enzymes incorporating resilient features from Prochlorococcus variants

  • Stress-resistant ATP production:

    • Transfer thermostability features from tropical ecotypes to industrial production strains

    • Develop salt-tolerant ATP synthase variants for use in non-freshwater cultivation systems

    • Engineer oxidative stress resistance for increased production robustness

Biosensor development:

  • Environmental monitoring tools:

    • Create ATP synthase-based biosensors for detecting marine pollutants

    • Develop systems that respond to specific environmental parameters (temperature, pH, nutrients)

    • Engineer reporter outputs coupled to ATP synthase activity or assembly

  • Advanced ATP sensing platforms:

    • Build upon iATPSnFR2 technology to create sensors with expanded capabilities

    • Develop variants with different affinities for monitoring diverse ATP concentration ranges

    • Engineer sensors with additional specificity for ADP/ATP ratio determination

Structural biology insights:

  • Nanomachine design principles:

    • Analyze the rotary mechanism adaptations in different Prochlorococcus ecotypes

    • Apply insights to design synthetic molecular motors

    • Develop simplified models for teaching and research purposes

  • Protein engineering templates:

    • Identify stability-enhancing mutations from deep-sea ecotypes

    • Apply directed evolution to enhance desirable properties

    • Create databases of functional mutations across domains for rational design

Theoretical framework for applications:

Prochlorococcus AdaptationMechanismBiotechnological Application
Oligotrophy toleranceEfficient ATP production at low resource levelsLow-input bioproduction systems
Temperature adaptationStructural modifications preserving function across thermal rangesRobust industrial enzymes
Light intensity adaptationOptimized energy coupling under varying photon fluxEnhanced photobioreactors
Pressure tolerance (deep ecotypes)Structural stability under compressionPressure-resistant bioprocesses

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.