Recombinant Prochlorococcus marinus Cytochrome b6-f complex iron-sulfur subunit (petC)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
petC; A9601_05181; Cytochrome b6-f complex iron-sulfur subunit; Plastohydroquinone:plastocyanin oxidoreductase iron-sulfur protein; ISP; RISP; Rieske iron-sulfur protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-178
Protein Length
full length protein
Species
Prochlorococcus marinus (strain AS9601)
Target Names
petC
Target Protein Sequence
MTQLSSNDVPSMGRRQFMNLLTFGTATGVALGALYPVANYFMPLRAGGGGGGTSAKDELG NPITKTGWLATHQAGDRSLVQGLKGDPTYLIVNEGGEIGEFGLNAICTHLGCVVPWDSGA NKFICPCHGSQYDTNGKVVRGPAPLSLALAHVDIEDDAVLVKQWSETDFRTNENPWWA
Uniprot No.

Target Background

Function
A component of the cytochrome b6-f complex. This complex facilitates electron transfer between photosystem II (PSII) and photosystem I (PSI), cyclic electron flow around PSI, and state transitions.
Database Links
Subcellular Location
Cellular thylakoid membrane; Single-pass membrane protein.

Q&A

What is the function of the iron-sulfur subunit (petC) in the Prochlorococcus marinus Cytochrome b6-f complex?

The iron-sulfur subunit (petC) in the Cytochrome b6-f complex contains a [2Fe-2S] cluster that serves as an essential electron carrier in the electron transport chain during photosynthesis. This subunit accepts electrons from plastoquinol at the Qp site and transfers them to plastocyanin or cytochrome c6, creating a proton gradient across the thylakoid membrane that drives ATP synthesis. In Prochlorococcus, this process is particularly optimized for low-light environments where many strains thrive, especially in the high B/A (chlorophyll b to chlorophyll a ratio) ecotypes like MIT 9313 .

The methodology to study this function involves spectroscopic analyses, including optical and electron paramagnetic resonance (EPR) spectroscopy. EPR measurements, typically conducted at low temperatures (around 10K), can directly probe the redox states of the iron-sulfur cluster in different physiological conditions .

How does the petC gene differ between high-light and low-light adapted Prochlorococcus strains?

The petC gene shows notable variations between high-light and low-light adapted Prochlorococcus strains, reflecting their adaptation to different ecological niches. High-light adapted strains like MED4 typically show streamlined genomes with fewer gene duplications, whereas low-light adapted strains like MIT 9313 often maintain more genetic redundancy in key photosynthetic components .

To investigate these differences, comparative genomic analysis should be performed using sequence alignment tools like MUSCLE or CLUSTAL, followed by phylogenetic analysis. PCR-based approaches with strain-specific primers can be used to amplify petC from different ecotypes, followed by sequencing to identify key polymorphisms that might affect protein function or regulation.

What structural features characterize the iron-sulfur subunit in Prochlorococcus compared to other cyanobacteria?

Structural analysis requires protein purification protocols similar to those used for other Cytochrome b6-f complexes, involving membrane solubilization with detergents like UDM (n-undecyl-β-D-maltopyranoside), followed by column chromatography and gradient ultracentrifugation . Cryo-electron microscopy has emerged as a powerful technique for resolving the structure of these complexes, allowing visualization of protein-protein interactions and cofactor arrangements at near-atomic resolution.

What are the optimal conditions for expressing recombinant Prochlorococcus marinus petC in heterologous systems?

For recombinant expression of Prochlorococcus marinus petC, several heterologous systems can be employed with the following optimized conditions:

E. coli-based expression:

  • Recommended strains: BL21(DE3) for standard expression; Origami or SHuffle strains for improved disulfide bond formation

  • Expression vector: pET-28a(+) with an N-terminal His-tag for purification

  • Induction: 0.1-0.5 mM IPTG at OD600 of 0.6-0.8

  • Post-induction temperature: 18-22°C for 16-20 hours to improve proper folding

  • Supplementation with iron and sulfur sources (ferric citrate, ferrous ammonium sulfate) may enhance [2Fe-2S] cluster incorporation

Cyanobacterial expression (Synechocystis PCC 6803):

  • Integration vector targeting neutral sites

  • Light conditions: 40-50 μmol photons m^-2 s^-1, 12:12 light:dark cycle

  • Temperature: 28-30°C

  • Medium: BG-11 supplemented with appropriate antibiotics

Protein extraction requires careful handling to maintain the integrity of the iron-sulfur cluster, preferably performed under anaerobic conditions with reducing agents.

What purification strategies yield the highest activity for recombinant Prochlorococcus petC protein?

A multi-step purification strategy is recommended to obtain high-activity recombinant petC protein:

  • Initial extraction: Solubilize membranes using 1% UDM (n-undecyl-β-D-maltopyranoside) in buffer containing 30 mM Tris-HCl (pH 7.5), 50 mM NaCl, 5 mM MgCl2, and protease inhibitors .

  • Affinity chromatography: For His-tagged constructs, use Ni-NTA resin with gradient elution (50-300 mM imidazole).

  • Ion-exchange chromatography: Apply sample to a propyl-Sepharose column equilibrated with buffer containing decreased detergent concentration (0.7-1 mM UDM) and ammonium sulfate (37% saturation). Elute with decreasing ammonium sulfate concentration (30-20%) .

  • Size exclusion: Perform sucrose gradient ultracentrifugation (10-25% continuous gradient) at 141,000g for 16 hours at 4°C .

  • Activity verification: Confirm protein activity by measuring cytochrome reduction/oxidation spectroscopically. Active Cytochrome b6-f complex should demonstrate turnover rates of approximately 120 per second in standardized assays using plastocyanin as electron acceptor .

Throughout purification, maintain low temperature (4°C) and include reducing agents to protect the iron-sulfur cluster.

How can researchers assess the integrity and functional activity of purified recombinant petC protein?

Multiple complementary approaches should be used to assess both structural integrity and functional activity:

Structural integrity assessment:

  • SDS-PAGE followed by western blotting with anti-petC antibodies

  • UV-visible spectroscopy to verify characteristic absorbance peaks of the [2Fe-2S] cluster (typically ~420-460 nm)

  • Circular dichroism spectroscopy to confirm proper protein folding

  • EPR spectroscopy at 10K to directly probe the iron-sulfur cluster, with measurement parameters: microwave frequency ~9.39 GHz, microwave power ~6.35 mW, modulation amplitude ~1.5 mT

Functional activity assays:

  • Electron transfer capacity can be measured by monitoring reduction of artificial electron acceptors or natural partners like plastocyanin

  • Calculate turnover rates by measuring the initial slope of plastocyanin reduction after addition of the purified complex and reduced decylplastoquinol (dPQH2) as substrate

  • Reconstitution into liposomes to assess proton translocation activity across membranes

A fully functional recombinant protein should demonstrate spectral properties consistent with an intact [2Fe-2S] cluster and electron transfer rates comparable to those of native protein complexes isolated from Prochlorococcus.

How do mutations in conserved cysteine residues affect the redox properties of the Prochlorococcus petC iron-sulfur cluster?

The iron-sulfur cluster in petC is coordinated by four conserved cysteine residues. Site-directed mutagenesis of these residues can dramatically alter the redox properties of the cluster, affecting both its midpoint potential and stability. Research methodologies to investigate these effects include:

  • Site-directed mutagenesis: Generate a panel of mutants with substitutions at each conserved cysteine (typically to serine or alanine), as well as mutations in surrounding residues that may influence the electronic environment.

  • Redox titration: Determine the midpoint potentials of wild-type and mutant proteins using spectroelectrochemical methods with mediators covering appropriate potential ranges.

  • Temperature stability analysis: Assess the thermal stability of mutants using differential scanning calorimetry or temperature-dependent spectroscopy.

  • EPR spectroscopy: Characterize changes in g-values and linewidths of the EPR signal, which reflect alterations in the electronic structure of the cluster. Low temperature (10K) measurements with appropriate parameters are essential for iron-sulfur cluster analysis .

  • Functional reconstitution: Measure electron transfer rates in reconstituted systems to correlate structural changes with functional impact.

Recent studies suggest that even conservative mutations can significantly alter cluster properties, with variations in midpoint potential of up to 100 mV observed in similar iron-sulfur proteins from other organisms.

What role does the petC subunit play in supercomplex formation in Prochlorococcus thylakoid membranes?

The petC subunit likely contributes to the formation and stability of photosynthetic supercomplexes that enhance electron transfer efficiency in Prochlorococcus thylakoid membranes. To investigate this role:

  • Membrane fragment isolation: Carefully isolate native thylakoid membranes using differential centrifugation with buffer containing appropriate detergents like UDM (0.7-1 mM) .

  • Mild solubilization conditions: Use digitonin (0.5-1%) for gentle solubilization that preserves supercomplex interactions.

  • Blue-native PAGE: Separate intact supercomplexes and identify components using second-dimension SDS-PAGE or mass spectrometry.

  • Cryo-electron microscopy: Apply single-particle analysis to visualize supercomplex architecture at high resolution, using equipment similar to that described in the literature (Titan Krios G3i microscope at 300 kV, K3 direct electron detector) .

  • Crosslinking mass spectrometry: Identify specific interaction sites between petC and partner proteins.

  • Mutagenesis of potential interaction surfaces: Generate targeted mutations in predicted interaction regions to disrupt supercomplex formation.

This approach has revealed that in other photosynthetic organisms, the iron-sulfur subunit forms critical contacts with both photosystem I and NADH dehydrogenase-like complexes in supercomplexes that facilitate cyclic electron flow.

How do the quinone channels in Prochlorococcus Cytochrome b6-f complex differ from those in plants and other cyanobacteria?

Recent high-resolution structures of plant Cytochrome b6-f have revealed a distinctive arrangement of plastoquinones forming a "one-way traffic" model for efficient quinol oxidation . To compare this with Prochlorococcus:

  • Protein purification and structure determination: Isolate native or recombinant Prochlorococcus Cytochrome b6-f complex using protocols adapted from those used for plant complexes , followed by cryo-EM structure determination.

  • Computational cavity analysis: Employ algorithms like CAVER or HOLE to identify and characterize potential quinone-binding channels in the obtained structures.

  • Molecular dynamics simulations: Perform simulations with embedded quinones to analyze their movement within identified channels.

  • Site-directed mutagenesis: Generate mutations of key residues lining potential quinone channels and assess their impact on enzymatic activity.

  • Activity assays with quinone analogs: Compare activity with quinones of different tail lengths to probe channel constraints.

The plant Cytochrome b6-f complex shows three plastoquinones lined up head-to-tail near the Qp site, suggesting a unidirectional flow through the complex . Comparative analysis would reveal whether Prochlorococcus has evolved variations in this channel structure that might reflect adaptation to its specific ecological niche and electron transport requirements.

How does the petC sequence and expression vary across different Prochlorococcus ecotypes?

Prochlorococcus ecotypes show significant genomic adaptations to different light and nutrient conditions, which extend to the photosynthetic apparatus including the petC gene. To analyze these variations:

  • Comparative genomics: Align petC sequences from diverse Prochlorococcus ecotypes including high-light adapted strains like MED4 and low-light adapted strains like MIT 9313 . Calculate nucleotide and amino acid substitution rates, Ka/Ks ratios, and identify positions under positive selection.

  • Promoter analysis: Compare upstream regulatory regions to identify potential differences in expression regulation.

  • Transcriptomics: Analyze RNA-seq data across ecotypes under various light conditions to quantify differences in petC expression.

  • Proteomics: Use quantitative proteomics to determine if protein abundance correlates with transcript levels or suggests post-transcriptional regulation.

This comparative approach has revealed that while core photosynthetic components are generally conserved, Prochlorococcus strains show notable variations in gene copy number and regulatory elements that influence their adaptation to specific light niches .

StrainAdaptationpetC Copy NumberNotable Features
MED4High-lightSingle copyStreamlined genome, modified β phycoerythrin
MIT 9313Low-lightSingle copyContains gene cluster for chromophorylated phycoerythrin
SS120Low-lightSingle copyHigh chlorophyll b/a ratio for efficient low-light harvesting
NATL2AIntermediateSingle copyIntermediate light adaptation traits

What structural adaptations in petC might contribute to the remarkable ecological success of Prochlorococcus in oligotrophic oceans?

The ecological success of Prochlorococcus in nutrient-poor environments may be partially attributed to specific adaptations in the petC protein that enhance electron transport efficiency while minimizing resource requirements:

  • Comparative structural biology: Determine structures of petC from multiple ecotypes using X-ray crystallography or cryo-EM and compare with other cyanobacteria.

  • Metal content analysis: Quantify iron content using inductively coupled plasma mass spectrometry (ICP-MS) to determine if there are adaptations for iron economy.

  • Enzyme kinetics across ecotypes: Measure electron transfer rates and substrate affinities across different temperatures and light conditions representative of various ocean depths.

  • Protein stability measurements: Compare thermal and chemical stability to identify adaptations that might provide resilience in fluctuating environments.

Prochlorococcus has evolved several adaptations in its photosynthetic apparatus, including modified light-harvesting systems with unique Prochlorophyte Chlorophyll-Binding proteins (Pcbs) . Similar specialized adaptations in the electron transport chain, including the petC subunit, likely contribute to its ability to thrive with minimal nutrient requirements in oligotrophic oceans.

How can structural information about petC inform directed evolution approaches for enhancing photosynthetic efficiency?

Recent high-resolution structural studies of the Cytochrome b6-f complex provide a foundation for rational design and directed evolution of petC to enhance photosynthetic efficiency:

  • Structure-guided mutagenesis: Based on high-resolution structures, identify residues that might influence electron transfer rates or stability for targeted mutagenesis.

  • Library construction methods:

    • Error-prone PCR with controlled mutation rates

    • Site-saturation mutagenesis at key positions

    • DNA shuffling between petC genes from different ecotypes

  • Selection strategies:

    • Growth-coupled selection in photoautotrophic host organisms

    • High-throughput screening using fluorescent reporters linked to electron transport activity

    • Compartmentalized self-replication techniques

  • Validation of improved variants:

    • Detailed kinetic characterization

    • Structural analysis of successful variants

    • Integration into model photosynthetic organisms to confirm phenotypic improvements

This approach has successfully enhanced properties of other iron-sulfur proteins and could be particularly valuable for engineering Prochlorococcus components for biotechnological applications in sustainable energy production.

What insights can comparative analysis of petC across marine cyanobacteria provide about the evolution of oxygenic photosynthesis?

The petC subunit is highly conserved across oxygenic photosynthetic organisms but shows specific adaptations in different lineages. Comparative analysis can provide evolutionary insights:

  • Phylogenetic analysis: Construct robust phylogenetic trees based on petC sequences from diverse cyanobacteria, including both Prochlorococcus ecotypes and other marine and freshwater species.

  • Ancestral sequence reconstruction: Infer ancestral petC sequences at key evolutionary nodes and potentially synthesize these proteins for functional characterization.

  • Structural comparison: Identify conserved versus variable regions through comparative structural analysis, particularly focusing on regions involved in protein-protein interactions.

  • Correlation with ecological parameters: Analyze how specific sequence features correlate with ecological niches across the cyanobacterial phylogeny.

Prochlorococcus has several unusual features compared to other cyanobacteria, including its use of divinyl chlorophyll a/b and the presence of genes for Rubisco and carboxysomal proteins that are likely of non-cyanobacterial origin . Similarly, analysis of petC might reveal unexpected evolutionary patterns that have contributed to the remarkable diversification of photosynthetic organisms across marine environments.

How does the interaction between petC and plastocyanin or cytochrome c6 vary between Prochlorococcus strains from different ocean depths?

The interaction between petC and its electron acceptors (plastocyanin or cytochrome c6) is critical for photosynthetic efficiency and may be optimized differently across ecotypes adapted to different ocean depths:

  • Protein-protein interaction analysis:

    • Co-immunoprecipitation with tagged proteins

    • Surface plasmon resonance to measure binding kinetics

    • Isothermal titration calorimetry for thermodynamic parameters

    • Cryo-EM of the complex, similar to methods used for plant Cytochrome b6-f with plastocyanin

  • Mutational analysis of interaction interfaces:

    • Alanine-scanning mutagenesis of predicted interface residues

    • Charge-swap experiments to validate electrostatic interactions

  • Comparative kinetics across ecotypes:

    • Measure electron transfer rates using stopped-flow spectroscopy

    • Analyze temperature dependence to determine activation parameters

  • Computational analysis:

    • Molecular dynamics simulations of encounter complexes

    • Brownian dynamics to model diffusion-limited association

Recent high-resolution structures of plant Cytochrome b6-f in complex with plastocyanin provide templates for modeling these interactions in Prochlorococcus . Preliminary comparisons suggest that low-light adapted strains may have evolved interaction surfaces that favor stronger binding to compensate for lower collision frequencies in energy-limited environments.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.