Recombinant Prochlorococcus marinus Cytochrome b6-f complex subunit 4 (petD)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Prochlorococcus marinus Cytochrome b6-f Complex Subunit 4 (petD)

Recombinant Prochlorococcus marinus Cytochrome b6-f complex subunit 4 (petD) refers to a specific subunit of the cytochrome b6-f complex, which is essential for photosynthetic electron transport in oxygenic photosynthetic organisms . Prochlorococcus marinus is a marine cyanobacterium known for its global abundance and significant role in marine photosynthesis . The cytochrome b6-f complex, a protein complex found in the thylakoid membranes of cyanobacteria, algae, and plants, mediates electron transfer between Photosystem II (PSII) and Photosystem I (PSI) . Subunit 4, or petD, is a component of this complex.

Role of Cytochrome b6-f Complex

The cytochrome b6-f complex plays a vital role in linking the two photosystems in the electron transport chain, facilitating the transfer of electrons from PSII to PSI . This complex oxidizes plastoquinol and reduces plastocyanin, contributing to the generation of a proton gradient across the thylakoid membrane, which drives ATP synthesis .

PetD Subunit

PetD is one of the subunits of the cytochrome b6-f complex, and it is essential for the assembly, stability, and function of the complex . The petD subunit is a small hydrophobic protein that interacts with other subunits to form a stable complex .

Prochlorococcus marinus

Prochlorococcus marinus is a marine cyanobacterium that contributes significantly to global photosynthesis . Its compact genome encodes a complete set of enzymes for essential biosynthetic pathways and photosynthetic machinery .

Importance of PetD

PetD is critical for the stabilization and function of the cytochrome b6-f complex . Studies on mutants lacking PetD have shown impaired photosynthetic electron transport and reduced growth, highlighting the importance of this subunit .

Research and Findings

  • Stability and Function: PetD is essential for maintaining the function of the cytochrome b6-f complex, likely through its close interaction with core subunits, forming a tight structure that stabilizes the complex core .

  • Electron Transport: Mutants lacking PetD exhibit impaired photosynthetic electron transport, emphasizing its importance in the electron transfer process between photosystems II and I .

  • Structural Studies: Structural analyses of the cytochrome b6-f complex have revealed the arrangement of subunits, including PetD, providing a basis for understanding its role in complex assembly and function .

  • Evolutionary Conservation: PetD is relatively conserved between higher plants and cyanobacteria, indicating its importance in photosynthetic organisms .

Recombinant PetD

Recombinant PetD refers to the PetD subunit produced through recombinant DNA technology. This involves cloning the petD gene from Prochlorococcus marinus into an expression vector, expressing it in a host organism such as E. coli, and purifying the resulting protein . Recombinant PetD is used for biochemical and biophysical studies, structural analysis, and functional assays to understand its role in the cytochrome b6-f complex.

Applications of Recombinant PetD

  1. Structural Studies: Recombinant PetD can be used to determine the three-dimensional structure of the cytochrome b6-f complex using X-ray crystallography or cryo-electron microscopy .

  2. Functional Assays: Recombinant PetD is employed in assays to study its interactions with other subunits of the complex and its role in electron transfer and proton translocation .

  3. Biochemical Studies: Recombinant PetD can be used to investigate its redox properties, binding affinities, and regulatory mechanisms .

Product Specs

Form
Lyophilized powder

Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.

Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.

Note: All proteins are shipped with standard blue ice packs unless dry ice is specifically requested in advance. Additional fees apply for dry ice shipping.

Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted to your specifications.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid forms have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.

The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its implementation.

Synonyms
petD; A9601_03501; Cytochrome b6-f complex subunit 4; 17 kDa polypeptide
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-160
Protein Length
full length protein
Species
Prochlorococcus marinus (strain AS9601)
Target Names
petD
Target Protein Sequence
MSTLKKPDLSDPKLRAKLAKGMGHNYYGEPAWPNDLLYIFPVVILGTIACVVGLAVLDPA MLGDKANPFATPLEILPEWYLYPVFQILRVVPNKLLGIALQTLIPLGLMILPFIENVNKF SNPFRRPIAMSVFLFGTFLTIYLGIGACLPIDKSLTLGLF
Uniprot No.

Target Background

Function

Recombinant Prochlorococcus marinus Cytochrome b6-f complex subunit 4 (petD) is a component of the cytochrome b6-f complex. This complex mediates electron transfer between photosystem II (PSII) and photosystem I (PSI), facilitates cyclic electron flow around PSI, and participates in state transitions.

Database Links
Protein Families
Cytochrome b family, PetD subfamily
Subcellular Location
Cellular thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the structure and function of the petD subunit within the cytochrome b6-f complex?

The petD gene encodes subunit IV of the cytochrome b6-f complex, which corresponds to the C-terminal half of the cytochrome b subunit found in the bc1 complex. In spinach thylakoid membranes, this subunit has a molecular weight of approximately 17.5 kDa . Functionally, the petD subunit forms part of the redox core of the complex alongside other key subunits (petA, petB, and petC).

The cytochrome b6-f complex as a whole contains eight polypeptide subunits that collectively bind or coordinate five tightly bound metallo-redox prosthetic groups. These include four hemes (f, bp, bn, and cn) and the 2Fe-2S 'Rieske' iron-sulfur protein, which together form the conserved redox core essential for electron transport .

How does Prochlorococcus marinus petD differ from that of other cyanobacteria?

Prochlorococcus marinus represents a unique cyanobacterial lineage that has undergone significant genome streamlining during evolution, resulting in strain-specific adaptations. Different P. marinus ecotypes (such as high-light adapted MED4 and low-light adapted MIT 9313) show distinctive genetic adaptations related to their photosynthetic apparatus .

While specific sequence variations within petD are strain-dependent, the general structure maintains evolutionary conservation necessary for function. For example, the P. marinus cytochrome b6-f complex retains the core functionality found in other cyanobacteria, though potentially with adaptations that optimize performance in its ecological niche. Unlike more complex cyanobacteria, Prochlorococcus has evolved toward minimal genomic content while maintaining essential photosynthetic functions .

What expression systems are most suitable for recombinant production of P. marinus petD?

For recombinant expression of membrane proteins like the petD subunit, several expression systems can be considered based on experimental requirements:

Expression SystemAdvantagesLimitationsSuitable For
E. coliFast growth, high yield, inexpensivePotential misfolding, lack of post-translational modificationsInitial structural studies, antibody production
Cyanobacterial hosts (Synechocystis)Native-like membrane environment, relevant post-translational modificationsLower yield, slower growthFunctional studies requiring authentic folding and assembly
Cell-free systemsAvoids toxicity issues, direct incorporation of labeled amino acidsHigher cost, potentially lower yieldNMR studies, rapid screening
Yeast (P. pastoris)Eukaryotic folding machinery, moderate to high yieldPotential glycosylation differencesLarger scale production for biochemical studies

The choice of expression system should align with the specific research questions being addressed. For structural studies requiring authentic folding, cyanobacterial hosts provide advantages despite their typically lower yields compared to E. coli systems.

What purification strategies yield the highest purity of recombinant petD protein?

Purification of the petD subunit presents challenges due to its hydrophobic nature and membrane integration. A multi-step purification approach is typically required:

  • Membrane fraction isolation: Differential centrifugation following cell lysis to isolate membrane fractions.

  • Detergent solubilization: Careful selection of detergents is critical. Common options include:

    • n-Dodecyl β-D-maltoside (DDM) for initial solubilization

    • Digitonin for maintaining protein-protein interactions

    • Lauryl maltose neopentyl glycol (LMNG) for increased stability

  • Affinity chromatography: Utilizing engineered tags (His6, Strep-tag II) for selective capture.

  • Size exclusion chromatography: Final polishing step to separate monomeric, properly folded protein from aggregates.

  • Quality assessment: SDS-PAGE, Western blotting, and mass spectrometry to confirm purity and identity.

When working specifically with the entire cytochrome b6-f complex, additional considerations for maintaining the integrity of the multi-subunit assembly and associated prosthetic groups should be implemented.

How can I design experiments to study petD interactions with other subunits in the cytochrome b6-f complex?

Studying protein-protein interactions within membrane protein complexes requires specialized approaches. For the petD subunit, consider these methodologies:

  • Cross-linking coupled with mass spectrometry: Utilizes chemical cross-linkers of defined length to capture transient and stable interactions between petD and other subunits. After cross-linking, proteolytic digestion and mass spectrometry analysis can identify interaction interfaces.

  • FRET (Förster Resonance Energy Transfer): By introducing fluorescent protein tags or labels at strategic positions, FRET can detect proximity between petD and other subunits in reconstituted systems or native membranes.

  • Co-immunoprecipitation with subunit-specific antibodies: Requires development of highly specific antibodies against petD and other complex components.

  • Mutational analysis: Systematic mutation of conserved residues in petD followed by functional assays to identify residues critical for interactions and assembly.

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS): Provides information about solvent accessibility and conformational dynamics at interaction interfaces.

When designing these experiments, it's crucial to consider how the eight polypeptide subunits of the cytochrome b6-f complex (petA, petB, petC, and petD being the four major ones) interact to coordinate the five metallo-redox prosthetic groups that form the functional redox core .

What analytical methods are most appropriate for characterizing the redox properties of recombinant petD within the assembled cytochrome b6-f complex?

Characterization of redox properties requires methods that can precisely measure electron transfer and redox states:

  • Cyclic voltammetry: Provides direct measurement of redox potentials when the complex is immobilized on electrode surfaces.

  • EPR (Electron Paramagnetic Resonance) spectroscopy: Particularly useful for studying the paramagnetic centers within the complex, including interaction with other redox-active components.

  • Time-resolved absorption spectroscopy: Enables monitoring of electron transfer events in real-time following photoactivation or chemical reduction.

  • Potentiometric titrations: Can determine midpoint potentials of individual redox components within the assembled complex.

  • Stopped-flow kinetics: Allows measurement of rapid electron transfer rates between components.

Data analysis should account for the multiple redox-active components within the complex, including the four hemes (f, bp, bn, and cn) and the 2Fe-2S Rieske iron-sulfur protein that collectively form the redox core .

How do different P. marinus ecotypes (high-light vs. low-light adapted) show variation in petD structure and function?

Prochlorococcus marinus ecotypes have evolved distinct adaptations to different light conditions, which extends to their photosynthetic apparatus:

EcotypeRepresentative StrainsKey AdaptationspetD Characteristics
High-light adaptedMED4Smaller genome, simplified light-harvesting apparatus, single pcb genePotentially optimized for rapid electron transport
Low-light adaptedMIT 9313, NATL1A, NATL2ALarger genomes, more complex light-harvesting systems, multiple pcb genesMay favor efficiency over rate

The cytochrome b6-f complex, including the petD subunit, likely shows functional adaptations that complement these differences in light-harvesting strategy. The low-light adapted strains with their more extensive antenna systems may require corresponding adjustments in electron transport chain components to balance electron flow with photon capture rates .

Research approaches to investigate these differences include:

  • Comparative sequence analysis of petD across ecotypes

  • Expression of recombinant petD from different ecotypes followed by functional characterization

  • Measurement of electron transfer rates under varying light conditions

  • Structural analysis to identify adaptive modifications to the protein

What approaches can resolve contradictory data regarding petD assembly kinetics in reconstituted systems?

When facing contradictory findings regarding assembly kinetics of petD into the functional cytochrome b6-f complex, consider these systematic troubleshooting approaches:

  • Standardize experimental conditions: Ensure consistency in detergent composition, lipid environment, temperature, pH, and ionic strength across experiments.

  • Time-resolved analysis: Implement pulse-chase experiments with isotope-labeled petD to monitor incorporation rates into the complex under varying conditions.

  • Single-molecule techniques: Apply fluorescence correlation spectroscopy or single-particle tracking to observe assembly events at the individual molecule level.

  • Comparative analysis across expression systems: Test whether assembly kinetics differ when components are expressed in different systems (E. coli vs. cyanobacterial hosts).

  • Mathematical modeling: Develop kinetic models of the assembly process that incorporate all measured parameters and can help identify the source of discrepancies.

A systematic evaluation table should be developed to track variables that might influence assembly kinetics:

VariableRange TestedEffect on AssemblyPotential Mechanism
Lipid compositionVaries by experimentSignificant impactMembrane fluidity affects lateral diffusion
Divalent cations0-10 mMModerate to highStabilization of protein-protein interfaces
Temperature4-37°CHigh impactAffects folding and interaction kinetics
Redox environmentReduced/oxidizedVariableMay influence conformation of key residues
Presence of chaperonesWith/withoutHigh impactAssistance in proper folding

How can I design experiments to study the role of petD in electron transport under varying environmental conditions?

Studying the functional role of petD under different environmental conditions requires approaches that can measure electron transport activity while systematically varying parameters:

  • Reconstituted proteoliposome systems: Incorporate purified cytochrome b6-f complex containing recombinant petD into liposomes with defined lipid composition, allowing precise control of the experimental environment.

  • Oxygen electrode measurements: Quantify electron transport rates by measuring oxygen consumption or production under varying conditions.

  • Spectroscopic techniques: Track changes in redox states of various components in the electron transport chain using wavelength-specific absorption measurements.

  • Site-directed mutagenesis: Introduce specific mutations in petD to test hypotheses about functional residues and their response to environmental changes.

  • In vitro electron transport assays: Use artificial electron donors and acceptors to isolate and study specific segments of the electron transport pathway.

Environmental variables to systematically test include:

Environmental ParameterExperimental RangeMeasurement ApproachExpected Impact
pH6.0-8.5Activity assays at fixed pH valuesAltered proton motive force generation
Temperature15-35°CTemperature-controlled reaction chambersChanges in enzyme kinetics and membrane fluidity
Light intensity0-2000 μmol photons m⁻² s⁻¹Controlled illumination during activity measurementsVariation in electron flow rates
Salt concentration0.2-1.0 M NaClActivity assays with varied ionic strengthEffects on protein-protein interactions
CO₂ concentration0-5%Coupled measurements with carbon fixationIntegration with downstream metabolism

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.