Recombinant Prochlorococcus marinus Divinyl chlorophyll a/b light-harvesting protein pcbD (pcbD)

Shipped with Ice Packs
In Stock

Description

Overview of PcbD in Prochlorococcus marinus

PcbD belongs to the family of divinyl chlorophyll (dvChl)-binding proteins that replace phycobilisomes in Prochlorococcus, allowing efficient harvesting of blue light (400–500 nm) prevalent in deep ocean habitats . Unlike typical light-harvesting complexes, Pcb proteins like PcbD are integral to thylakoid membranes and associate with dvChl a (absorption peak at 442 nm) and dvChl b (478 nm) . Recombinant PcbD retains these spectral properties while enabling controlled study of its structure and function .

Recombinant Production and Purification

Recombinant PcbD is synthesized using codon-optimized plasmids transfected into E. coli. Strains are cultured under controlled light and temperature conditions to mimic native Prochlorococcus environments . Post-expression, the His-tagged protein is purified via affinity chromatography. Production protocols emphasize retaining chlorophyll-binding capacity, verified through spectrophotometry .

Functional Role in Photosynthesis

  • Light Harvesting: PcbD enhances photosynthetic efficiency under low light by concentrating blue wavelengths, critical for Prochlorococcus survival at depths >100 m .

  • Energy Transfer: Directs absorbed photons to photosystems I and II (PSI/PSII) with minimal self-shading due to Prochlorococcus’s small cell size (0.5–0.7 μm) .

  • Ecotypic Adaptation: Genomic analyses reveal pcb gene diversification (e.g., copy number variation) across Prochlorococcus clades, enabling niche specialization .

Research Applications

Recombinant PcbD is utilized in:

  1. Photosynthetic Mechanisms: Studying energy transfer kinetics in engineered systems .

  2. Bioengineering: Developing synthetic light-harvesting materials inspired by Prochlorococcus efficiency .

  3. Ecological Modeling: Linking pcb gene diversity to oceanographic niche partitioning .

Open Questions and Future Directions

  • Chlorophyll Binding Dynamics: How do dvChl a/b ratios vary across recombinant PcbD isoforms?

  • Environmental Stressors: Impact of oxygen gradients and UV exposure on PcbD stability .

  • Horizontal Gene Transfer: Role in spreading pcb variants among marine microbes .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order notes. We will fulfill your request to the best of our ability.
Lead Time
Delivery times may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Note: Our proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer composition, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
pcbD; Pro_1167; Divinyl chlorophyll a/b light-harvesting protein PcbD
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-361
Protein Length
full length protein
Species
Prochlorococcus marinus (strain SARG / CCMP1375 / SS120)
Target Names
pcbD
Target Protein Sequence
MQTYGNPEVTYGWWAGNSVVTNRSGRFIASHVGHTGLICFAAGGSTLWELARYNPEIPMG HQSSLFLAHLASIGIGFDEAGAWTGVGVATIAIVHLILSMVYGGGGLLHGILFDENVEDS EVLQAKKFKLEWNNPDNQTFILGHHLIFMGVACAWFVEWARIHGIYDPALGAIRQVNYNL DLSMIWQRQFDFITIDSLEDVMGGHAFLAFAEITGGAFHIVAGSTPWEDKKLGEWSKFKG SELLSAEAVLSWSLAGIGWMAIVAAFWCASNTTVYPEAWYGEPLQFKFAISPYWVDTGDL SDATAFWGHSARAALTNVHYYLGFFFLQGHFWHALRALGFNFKNVTASIGNEQKATFTIK S
Uniprot No.

Target Background

Function
The antenna complex functions as a light receptor. It captures and delivers excitation energy to photosystems II and I. The Prochlorales pcb genes are not related to higher plant LHCs.
Database Links
Protein Families
PsbB/PsbC family, IsiA/Pcb subfamily
Subcellular Location
Cellular thylakoid membrane; Multi-pass membrane protein.

Q&A

What is Prochlorococcus marinus and why is its light-harvesting system significant?

Prochlorococcus marinus is a minute photosynthetic prokaryote, measuring only 0.5 to 0.7 μm in diameter, making it the smallest known photosynthetic organism . It is ubiquitous in oceanic regions between 40°S to 40°N latitudes and is likely the most abundant photosynthetic organism on Earth . Its ecological success is largely attributed to its unique photosynthetic apparatus, which includes specialized light-harvesting proteins.

The significance of Prochlorococcus light-harvesting systems lies in their remarkable adaptation to the blue-light dominated environments of deep ocean waters. The Pcb light-harvesting complexes show absorption maxima of 442 nm for divinyl chlorophyll a and 478 nm for divinyl chlorophyll b, allowing efficient harvesting of blue light in the 400-500 nm range that predominates in deep ocean environments . This specialized pigment system, combined with the organism's small cell size that minimizes intracellular self-shading, contributes to highly efficient light capture under low-light conditions .

How do divinyl chlorophyll proteins in Prochlorococcus differ from typical cyanobacterial light-harvesting systems?

Unlike typical cyanobacteria that primarily use phycobilisomes as their main light-harvesting antennae, Prochlorococcus marinus has evolved a distinctive system using divinyl derivatives of chlorophyll a (Chl a2) and chlorophyll b (Chl b2) . This represents a significant evolutionary adaptation that distinguishes Prochlorococcus from other photosynthetic prokaryotes.

The most notable differences include:

  • Pigment composition: Prochlorococcus possesses divinyl derivatives of chlorophyll a and b (Chl a2 and Chl b2) that are unique to this genus . These pigments have absorption and fluorescence excitation maxima in the blue part of the visible spectrum that are red-shifted by 8-10 nm compared to their monovinyl counterparts .

  • Antenna structure: Prochlorococcus utilizes light-harvesting complexes that are similar in function but not in structure to those of higher plants or green algae .

  • Mixed pigment system: Some Prochlorococcus strains contain a novel type of phycoerythrin in addition to the chlorophyll-based system, creating a unique combination of Chl a, Chl b, and at least one phycobiliprotein—a distinctive trait among oxygen-evolving phototrophs .

What are the structural characteristics of pcbD protein and how does it relate to other Pcb proteins?

The pcbD protein belongs to the family of Pcb (Prochlorococcus chlorophyll-binding) proteins that function as light-harvesting antennae in Prochlorococcus marinus. While the search results don't provide specific structural information about pcbD, we can infer its characteristics based on related Pcb proteins like pcbB.

The pcbB protein contains 349 amino acids and forms a membrane-spanning complex that binds divinyl chlorophyll molecules . By extension, pcbD likely shares similar structural properties, functioning as an integral membrane protein with multiple transmembrane helices that position the chlorophyll molecules for optimal light capture and energy transfer.

The amino acid sequence of these proteins typically contains conserved histidine residues that serve as ligands for the central magnesium atom of chlorophyll molecules. These structural features enable the precise orientation of chlorophyll molecules necessary for efficient light harvesting and energy transfer to photosynthetic reaction centers.

How do different Prochlorococcus ecotypes vary in their pcbD expression and function across ocean depth gradients?

Prochlorococcus marinus exhibits remarkable adaptation to different light regimes across ocean depth gradients through variations in its light-harvesting apparatus. Different genetically distinct ecotypes with varying pigment compositions and photosynthetic characteristics have evolved to thrive at different depths .

The ratio of Chl b2 to Chl a2 in natural Prochlorococcus populations ranges dramatically from 0.15 in surface waters to 2.9 below the deep chlorophyll maximum . This dramatic variation reflects the adaptive strategies employed by different ecotypes:

  • Surface ecotypes (high-light adapted): These typically have lower Chl b2/Chl a2 ratios, exemplified by the MED strain with a ratio of approximately 0.13 . They are adapted to high irradiance environments where maximizing light capture is less critical than preventing photodamage.

  • Deep ecotypes (low-light adapted): These show significantly higher Chl b2/Chl a2 ratios, sometimes exceeding 1.0 (as seen in the SARG strain) . The elevated proportion of Chl b2 enhances absorption in the blue-green region of the spectrum that penetrates to depth.

This vertical stratification of ecotypes with different pcb protein compositions represents a remarkable example of niche partitioning based on light quality and quantity. Research methods to study these variations typically involve:

  • Depth-discrete oceanographic sampling using specialized water collection systems

  • Flow cytometric sorting of natural Prochlorococcus populations

  • HPLC pigment analysis to quantify Chl a2 and Chl b2 content

  • Comparative genomics and transcriptomics to assess expression levels of pcb genes

What are the optimal expression systems and purification strategies for recombinant pcbD protein?

The expression and purification of membrane-bound light-harvesting proteins like pcbD present significant challenges due to their hydrophobic nature and requirement for cofactor (chlorophyll) incorporation. Based on approaches used for similar proteins, the following methodological framework is recommended:

Expression Systems:

  • E. coli-based systems:

    • C41(DE3) or C43(DE3) strains engineered for membrane protein expression

    • Codon-optimization of the pcbD gene for E. coli usage

    • Use of specialized vectors containing fusion tags (His6, MBP, or SUMO) to improve solubility

    • Temperature-controlled expression (typically 16-18°C) to reduce inclusion body formation

  • Eukaryotic systems:

    • Pichia pastoris for expression of complex membrane proteins

    • Insect cell/baculovirus systems for improved folding and post-translational modifications

Purification Strategy:

  • Membrane isolation by ultracentrifugation following cell disruption

  • Solubilization using mild detergents (n-dodecyl-β-D-maltoside or digitonin)

  • Affinity chromatography using engineered tags

  • Size-exclusion chromatography for final purification and buffer exchange

Cofactor Reconstitution:
For functional studies, reconstitution with chlorophyll pigments may be necessary. This can be achieved by:

  • Co-expression with chlorophyll biosynthesis genes

  • In vitro reconstitution with purified pigments

  • Verification of proper cofactor binding using absorption spectroscopy

How can contradictions in experimental data regarding pcbD function be systematically addressed?

When faced with contradictory results in pcbD research, a systematic approach is essential to resolve discrepancies and advance understanding. As noted in the search results, "in the evolution of real knowledge, [contradiction] marks the first step in progress toward a victory" .

Methodological Framework for Resolving Contradictions:

  • Identify potential sources of contradiction:

    • Different experimental conditions (light intensity, temperature, pH)

    • Strain-specific variations (genetic background, ecotype)

    • Technical differences in measurement approaches

    • Presence of unidentified regulatory factors

  • Experimental design to test competing hypotheses:

    • Side-by-side testing of different Prochlorococcus strains under identical conditions

    • Controlled manipulation of single variables to isolate effects

    • Use of multiple complementary techniques to measure the same parameter

  • Statistical approaches for data comparison:

    • Meta-analysis of published results to identify patterns

    • Bayesian analysis to update probability estimates as new evidence emerges

    • Principal component analysis to identify key factors driving variability

  • Collaborative approaches:

    • Multi-laboratory validation studies with standardized protocols

    • Round-robin testing of identical samples across different facilities

Case Study Application:
When examining contradictory findings regarding pcbD function across Prochlorococcus strains, researchers should systematically vary light intensity, temperature, and nutrient conditions while measuring photosynthetic efficiency. This approach has successfully resolved similar contradictions in studies of pcbB proteins, where differential responses to high light conditions were initially considered contradictory but were later explained through careful experimental design .

What spectroscopic techniques are most informative for characterizing pcbD-pigment interactions?

The characterization of pcbD-pigment interactions requires a combination of spectroscopic techniques to fully understand their structural arrangement and functional properties. Based on methods used for similar proteins, the following techniques are particularly valuable:

Absorption Spectroscopy:

  • UV-visible absorption spectroscopy provides the fundamental pigment signature

  • Differential absorption spectra can reveal subtle changes in pigment environments

  • Expected absorption maxima: ~442 nm for divinyl chlorophyll a and ~478 nm for divinyl chlorophyll b

Fluorescence Techniques:

  • Steady-state fluorescence emission spectra reveal energy transfer pathways

  • Time-resolved fluorescence measurements determine energy transfer kinetics

  • Fluorescence excitation spectra identify which pigments contribute to emission

Circular Dichroism (CD) Spectroscopy:

  • Provides information on the arrangement and coupling of pigments

  • Reveals structural organization of protein-pigment complexes

  • Sensitive to changes in protein secondary structure upon pigment binding

Resonance Raman Spectroscopy:

  • Identifies specific vibrational modes of bound pigments

  • Distinguishes between different chlorophyll species

  • Provides information about pigment-protein interactions at the molecular level

Data Analysis Approach:
Combining these techniques allows researchers to create comprehensive models of pcbD-pigment interactions. For example, when characterizing pcbB proteins, researchers found that the ratio of Chl b2 to Chl a2 varied dramatically among different isolates (from 0.13 to >1), with significant implications for light-harvesting efficiency . Similar analyses of pcbD would be expected to reveal distinctive spectral properties that reflect its specific role in the light-harvesting apparatus.

How can genetic manipulation approaches be used to study pcbD function in vivo?

Genetic manipulation provides powerful tools for understanding pcbD function within the living cell. Based on approaches used in similar photosynthetic systems, the following methodological framework is recommended:

Gene Knockout/Knockdown Strategies:

  • CRISPR-Cas9 system adapted for cyanobacterial genomes

  • Homologous recombination for complete gene deletion

  • Antisense RNA approaches for knockdown when complete deletion is lethal

  • Inducible promoter systems to control expression levels

Complementation and Heterologous Expression:

  • Reintroduction of wild-type or mutated pcbD genes to knockout strains

  • Cross-complementation between different Prochlorococcus ecotypes

  • Heterologous expression in model cyanobacteria (e.g., Synechocystis PCC 6803)

Site-Directed Mutagenesis:

  • Targeted mutation of conserved chlorophyll-binding residues

  • Domain swapping between pcbD and other Pcb proteins

  • Introduction of spectroscopic probes (e.g., fluorescent amino acids)

Phenotypic Analysis Methods:

  • Growth rate measurements under different light regimes

  • Oxygen evolution measurements to assess photosynthetic capacity

  • 77K fluorescence emission spectra to evaluate energy transfer efficiency

  • Electron transport rate measurements using PAM fluorometry

Data Collection and Analysis:
The photosynthetic phenotype should be characterized across multiple parameters. For example, when studying related proteins, researchers found that different Prochlorococcus strains with varying pigment ratios exhibited different photosynthetic efficiencies, with high Chl b2/Chl a2 ratio strains showing significantly higher maximum photosynthetic rates (Pm) under low light conditions .

How can researchers distinguish between pcbD and other light-harvesting proteins in mixed samples?

Distinguishing between closely related light-harvesting proteins in complex biological samples requires a multi-technique approach. The following methodological framework provides a systematic strategy:

Analytical Separation Techniques:

  • High-Performance Liquid Chromatography (HPLC):

    • Reverse-phase HPLC can separate protein-pigment complexes based on hydrophobicity

    • Size-exclusion HPLC separates proteins based on molecular dimensions

    • Ion-exchange chromatography leverages differences in surface charge distribution

  • Electrophoretic Methods:

    • Blue-native PAGE preserves protein-pigment interactions during separation

    • 2D electrophoresis combining isoelectric focusing with SDS-PAGE

    • Clear-native PAGE for gentle separation of membrane protein complexes

Immunological Approaches:

  • Western blotting with antibodies specific to pcbD epitopes

  • Immunoprecipitation to isolate pcbD-containing complexes

  • Immunofluorescence microscopy to localize pcbD within cells

Mass Spectrometry:

  • Peptide mass fingerprinting following tryptic digestion

  • Tandem MS/MS for sequence determination of signature peptides

  • Intact protein mass spectrometry to identify specific post-translational modifications

Spectroscopic Differentiation:
Exploit subtle differences in spectral properties between different Pcb proteins. For example, researchers have shown that different Prochlorococcus strains exhibit characteristic pigment ratios that correlate with their light adaptation strategies . The Chl b2/Chl a2 ratio varies dramatically between surface-adapted and deep-water ecotypes, ranging from 0.15 to 2.9 .

What are the critical factors affecting recombinant pcbD stability and functionality?

Maintaining stability and functionality of recombinant pcbD proteins requires careful attention to several critical factors throughout the expression, purification, and storage processes:

Expression Conditions:

  • Temperature: Lower expression temperatures (16-20°C) generally improve proper folding

  • Induction parameters: Concentration of inducer and induction timing affect protein quality

  • Host strain selection: Strains with chaperone co-expression can improve folding

  • Growth media composition: Supplementation with specific ions or cofactors may be necessary

Purification Considerations:

  • Detergent selection: Critical for membrane protein extraction

    • n-Dodecyl-β-D-maltoside (DDM) is often suitable for initial solubilization

    • Digitonin or amphipols may better preserve native structure for functional studies

  • Buffer composition:

    • pH typically maintained between 7.0-8.0

    • Ionic strength impacts protein-protein interactions

    • Addition of glycerol (5-10%) often improves stability

  • Lipid environment:

    • Consider nanodisc or liposome reconstitution for functional studies

    • Native lipid extracts may be required for optimal activity

Storage Parameters:

  • Temperature: Generally -80°C for long-term storage

  • Cryoprotectants: Addition of sucrose or trehalose (5-10%)

  • Aliquoting to minimize freeze-thaw cycles

  • Oxygen exposure: Consider storage under nitrogen to prevent oxidation

Functional Assessment:
Regular quality control using spectroscopic methods is essential. The unique absorption spectra of divinyl chlorophylls (442 nm for Chl a2 and 478 nm for Chl b2) provide convenient markers for functional integrity . Changes in these spectral properties can indicate protein denaturation or pigment loss.

How do variations in pcbD structure contribute to photoacclimation in different Prochlorococcus ecotypes?

Prochlorococcus marinus exhibits an extraordinary ability to grow and photosynthesize over a light intensity range spanning more than three orders of magnitude . This remarkable adaptability raises fundamental questions about the role of pcbD and other light-harvesting proteins in photoacclimation.

Current Understanding:
Recent research suggests two complementary mechanisms for Prochlorococcus photoacclimation:

  • Ecotype Diversification: Different Prochlorococcus strains possess antenna systems specifically adapted to their native light environments . This genetic adaptation is evidenced by:

    • High-light adapted ecotypes having lower Chl b2/Chl a2 ratios (around 0.13 in the MED strain)

    • Low-light adapted ecotypes having much higher ratios (often exceeding 1.0 in strains like SARG)

    • Some strains synthesizing monovinyl Chl b under high light conditions, suggesting differential regulation of biosynthetic pathways

  • Dynamic Acclimation: Individual strains modify their pigment composition in response to changing light conditions:

    • The Chl b2 content in natural populations varies 45-fold (from 0.1 to 4.5 fg cell−1)

    • The Chl a2 content shows more modest variation (12-fold, from 0.23 to 2.7 fg cell−1)

    • These changes are reflected in corresponding shifts in absorption and fluorescence excitation spectra

Methodological Approaches:
To investigate pcbD's role in these processes, researchers should employ:

  • Comparative genomics and transcriptomics across ecotypes

  • Time-course studies of gene expression following light shifts

  • Targeted mutagenesis of regulatory elements in pcbD genes

  • Heterologous expression of pcbD variants in model organisms

Data Interpretation Framework:
A comprehensive understanding requires integration of molecular, cellular, and ecological data across multiple scales. For example, variations in photosynthetic performance between strains with different pigment compositions directly impact their ecological distribution, with high Chl b2/Chl a2 ratio strains demonstrating superior performance under low light conditions .

What computational approaches are most effective for modeling pcbD-pigment interactions?

Advanced computational methods offer powerful tools for understanding the structural basis of pcbD function and predicting the effects of protein modifications. The following methodological framework outlines current approaches:

Structural Prediction Methods:

  • Homology modeling based on crystallized light-harvesting proteins

  • Ab initio protein structure prediction using algorithms like AlphaFold2

  • Molecular dynamics simulations to refine static models

  • Quantum mechanical calculations for chromophore-protein interactions

Simulation Approaches:

  • Molecular dynamics (MD) simulations:

    • All-atom MD with explicit solvent and membrane

    • Coarse-grained simulations for longer timescales

    • Steered MD to investigate conformational changes

  • Quantum mechanical/molecular mechanical (QM/MM) methods:

    • Essential for modeling excited state properties

    • Calculation of site energies and coupling strengths

    • Prediction of spectroscopic properties

Energy Transfer Modeling:

  • Förster Resonance Energy Transfer (FRET) calculations

  • Excitonic coupling models

  • Quantum coherence effects in energy transfer

Integration with Experimental Data:
Computational models should be validated and refined using experimental observations. For example, the absorption spectra showing maxima at 442 nm for divinyl chlorophyll a and 478 nm for divinyl chlorophyll b provide essential benchmarks for evaluating computational predictions of pigment-protein interactions.

Application to Research Questions: These computational approaches can address fundamental questions about pcbD function, such as how variations in protein sequence between ecotypes lead to different pigment binding properties and spectral characteristics. This information is critical for understanding the molecular basis of adaptation to different light environments across ocean depth gradients.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.