Recombinant Prochlorococcus marinus Glycerol-3-phosphate acyltransferase (plsY)

Shipped with Ice Packs
In Stock

Description

Membrane Topology

PlsY is an integral membrane protein with five transmembrane segments. Key structural features include:

  • Motif 1: Contains essential Serine (S) and Arginine (R) residues critical for catalysis .

  • Motif 2: Phosphate-binding loop (Glycine-rich) ensures G3P substrate binding .

  • Motif 3: Includes Histidine (H), Asparagine (N), and Glutamate (E) residues for structural stability and enzymatic activity .

Catalytic Function and Mechanism

PlsY operates in the sn-1 acylation pathway, transferring acyl groups to the sn-1 position of G3P. Unlike eukaryotic GPATs, bacterial PlsY lacks phosphatase activity, producing LPA instead of monoacylglycerol .

Key Catalytic Roles

  1. Substrate Binding:

    • Acylphosphate: Generated by PlsX (acyl-ACP → acyl-phosphate) .

    • Glycerol-3-phosphate: Bound via Motif 2’s glycine residues .

  2. Inhibition: Noncompetitively inhibited by palmitoyl-CoA .

Biological Relevance

  • Lipid Biosynthesis: Critical for membrane phospholipid assembly in Prochlorococcus, a dominant marine cyanobacterium .

  • Evolutionary Insights: Loss of plsY in some strains may reflect reduced lipid diversity, aligning with genome streamlining in oligotrophic environments .

Biochemical Studies

Study FocusFindingsSource
Membrane topologyFive transmembrane segments; conserved motifs for substrate binding
G3P binding affinityMutations in Motif 2 glycines increase Kₘ for G3P
Functional conservationHomologs in Synechocystis show dispensability due to alternative pathways

Recombinant Expression

  • Expression Vector: Cloned into pTrc99A or similar plasmids for E. coli production .

  • Purification: Lyophilized powder with >90% purity; avoids repeated freeze-thaw cycles .

Strain-Specific Variations

StrainUniProt IDProtein LengthNotes
MED4Q46JD91–198 aaMED4 carboxysomes show functional activity
MIT 9215A8G6D81–197 aaUsed in E. coli expression systems

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order. We will fulfill your request whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery time information.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipment, please inform us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, we recommend briefly centrifuging the vial prior to opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please communicate it to us, and we will prioritize developing the specified tag.
Synonyms
plsY; Pro_1408; Glycerol-3-phosphate acyltransferase; Acyl-PO4 G3P acyltransferase; Acyl-phosphate--glycerol-3-phosphate acyltransferase; G3P acyltransferase; GPAT; Lysophosphatidic acid synthase; LPA synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-205
Protein Length
full length protein
Species
Prochlorococcus marinus (strain SARG / CCMP1375 / SS120)
Target Names
plsY
Target Protein Sequence
MDFSISTIALFTLLVSYLLGSLPSGYLAGKWILGIDLREIGSGSTGATNVLRHVGKTPAL FVFFIDVTKGIGAILIAKSFLLDESLQIAAGLASLSGHIWPVWLKGKGGKAVATGLGVFL GISWQVGLGSLGIFLLILSIWRIVSLASISAAISLPVLMLINSKETFSIPYIVISFIAMI LVLWRHRSNLIRLIKGQEPRIGKSN
Uniprot No.

Target Background

Function
This enzyme catalyzes the transfer of an acyl group from acyl-phosphate (acyl-PO(4)) to glycerol-3-phosphate (G3P), resulting in the formation of lysophosphatidic acid (LPA). Notably, it utilizes acyl-phosphate as the fatty acyl donor, but not acyl-CoA or acyl-ACP.
Database Links
Protein Families
PlsY family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Prochlorococcus marinus Glycerol-3-phosphate acyltransferase (plsY) and what function does it serve?

Prochlorococcus marinus Glycerol-3-phosphate acyltransferase (plsY) is a membrane-bound enzyme that catalyzes the acylation of glycerol-3-phosphate at the sn-1 position to produce lysophosphatidic acid (LPA). This reaction represents a critical step in the de novo biosynthesis of phosphatidic acid, which serves as a precursor for various membrane glycerophospholipids . The enzyme is classified as an acyl-phosphate-glycerol-3-phosphate acyltransferase (EC 2.3.1.n3) and is also known as Acyl-PO4 G3P acyltransferase, G3P acyltransferase (GPAT) .

How does plsY differ from other acyltransferases in the GPAT family?

While plsY belongs to the broader GPAT family, it differs from other acyltransferases in several key aspects:

  • Substrate specificity: Unlike the PlsC family (another type of acyltransferase), which typically acts on lysophosphatidic acid, plsY specifically catalyzes the initial acylation step of glycerol-3-phosphate .

  • Prokaryotic origin: plsY from Prochlorococcus marinus represents a prokaryotic version of the enzyme, whereas plants have evolved specialized GPAT variants localized to different cellular compartments (plastid, endoplasmic reticulum, and mitochondria) .

  • Membrane integration: plsY is an integral membrane protein, which has historically made its solubilization and purification challenging without causing inactivation .

  • Sequence characteristics: The plsY protein sequence differs significantly between Prochlorococcus strains, reflecting evolutionary adaptation to different marine environments .

Which Prochlorococcus marinus strains are commonly used as sources for recombinant plsY production?

Several Prochlorococcus marinus strains have been utilized as sources for recombinant plsY production, including:

StrainUniProt IDProtein LengthNotable Features
MIT 9301A3PEG1197 aaHigh-light adapted ecotype
MIT 9215A8G6D8197 aaHigh-light adapted ecotype
NATL1AA2C4A0198 aaLow-light adapted ecotype
NATL2AQ46JD9198 aaLow-light adapted ecotype
SARG/CCMP1375/SS120Q7VAP9205 aaDeep-sea, low-light adapted strain

These different strains reflect the ecological diversity of Prochlorococcus, which has evolved to occupy various niches in the marine environment with varying light intensities and nutrient availabilities .

What expression systems are optimal for producing functional recombinant Prochlorococcus marinus plsY?

The optimal expression system for producing functional recombinant Prochlorococcus marinus plsY is E. coli, though specific methodological considerations are essential:

  • Expression vector selection: Vectors containing strong inducible promoters with His-tag fusion capabilities have proven successful for plsY expression .

  • Strain considerations: E. coli BL21(DE3) or similar expression strains are recommended due to their reduced protease activity and compatibility with membrane protein expression .

  • Expression conditions: Lower temperature induction (16-20°C) may improve proper folding of the membrane protein .

  • Solubilization strategy: As plsY is an integral membrane protein, appropriate detergents such as 6-cyclohexyl-1-hexyl-β-d-maltoside have been successfully used to solubilize similar acyltransferases without compromising activity .

  • Purification approach: Immobilized metal affinity chromatography (IMAC) using the N-terminal His-tag is the primary purification method, followed by size exclusion chromatography if higher purity is required .

This methodology has been validated through successful production of active recombinant plsY proteins from various Prochlorococcus strains .

How should recombinant plsY be stored to maintain optimal activity?

To maintain optimal activity of recombinant plsY, the following storage conditions are recommended:

  • Buffer composition: Tris-based buffer containing 50% glycerol is optimal for stabilizing the protein structure .

  • Temperature requirements: For short-term use (up to one week), store working aliquots at 4°C. For longer-term storage, maintain at -20°C, with extended storage at -80°C for maximum stability .

  • Aliquot preparation: Divide purified protein into single-use aliquots to avoid repeated freeze-thaw cycles, which can significantly reduce enzyme activity .

  • Handling precautions: Thaw frozen aliquots gently on ice immediately before use, and avoid storing diluted protein solutions .

  • Stability considerations: Even under optimal conditions, liquid formulations maintain activity for approximately 6 months at -20°C/-80°C, while lyophilized forms can retain activity for approximately 12 months .

These storage recommendations are critical for preserving the structural integrity and catalytic function of this membrane-associated enzyme .

What are the validated methods for assessing plsY enzymatic activity in vitro?

Several validated methods exist for assessing plsY enzymatic activity in vitro:

  • Radioisotope-based assay: Measuring the incorporation of radiolabeled glycerol-3-phosphate or acyl-CoA into lysophosphatidic acid products. This method offers high sensitivity but requires specialized safety protocols .

  • Coupled enzyme assays: Monitoring the release of CoA through coupling with auxiliary enzymes that generate a spectrophotometric or fluorometric signal proportional to enzyme activity .

  • LC-MS/MS analysis: Direct quantification of lysophosphatidic acid formation using liquid chromatography coupled with tandem mass spectrometry, which provides both sensitivity and specificity for product identification .

  • Direct spectrophotometric methods: For some acyltransferases, the release of CoA can be monitored at 412 nm in the presence of 5,5'-dithiobis-(2-nitrobenzoic acid) (DTNB) .

When designing activity assays, researchers should consider:

  • Buffer composition (typically Tris-HCl pH 7.5-8.0 with divalent cations)

  • Substrate concentrations (glycerol-3-phosphate and appropriate acyl donors)

  • Detergent concentrations (critical for solubilizing the enzyme while maintaining activity)

  • Reaction temperatures (typically 25-37°C depending on the strain origin)

How do sequence variations in plsY across different Prochlorococcus strains relate to ecological adaptation?

Sequence variations in plsY across different Prochlorococcus strains demonstrate a fascinating correlation with ecological adaptation:

  • Ecotype-specific patterns: High-light adapted ecotypes (e.g., MIT 9301, MIT 9215) and low-light adapted ecotypes (e.g., NATL1A, NATL2A, SS120) show distinctive amino acid sequence patterns in their plsY genes, reflecting adaptation to different light intensities and ocean depths .

  • Membrane composition adaptation: These variations appear to influence the substrate specificities of plsY, potentially leading to differences in membrane lipid composition that optimize cellular function under specific environmental conditions .

  • Evolutionary implications: Phylogenetic analysis suggests that plsY gene sequences can provide insights into the evolutionary history of Prochlorococcus strains, with evidence of both vertical inheritance and potential horizontal gene transfer events .

  • Microdiversity within ecotypes: Even within recognized ecotypes, there exists significant microdiversity in plsY sequences, with virtually no identical sequences in some populations, suggesting ongoing adaptation to microenvironmental conditions .

  • Correlation with genome size: Low-light adapted strains typically have larger genomes and exhibit greater sequence divergence in functional genes including plsY, possibly reflecting a more complex metabolic repertoire required for survival in deeper waters .

This sequence diversity underscores the importance of plsY in the ecological adaptation of Prochlorococcus to various marine niches and provides valuable insights into the mechanisms of evolutionary adaptation in this globally significant marine cyanobacterium .

What techniques are available for studying the membrane topology and structure-function relationships of plsY?

Advanced techniques for investigating the membrane topology and structure-function relationships of plsY include:

  • Site-directed mutagenesis approaches:

    • Systematic mutation of conserved residues to identify catalytic sites

    • Creation of chimeric proteins combining domains from different plsY variants to map functional regions

    • Introduction of cysteine residues for accessibility studies

  • Structural biology methods:

    • X-ray crystallography of detergent-solubilized protein (challenging but potentially feasible with newer detergents)

    • Cryo-electron microscopy for visualizing the protein in a near-native lipid environment

    • NMR spectroscopy for analyzing specific domains or the entire protein in membrane mimetics

  • Computational approaches:

    • Homology modeling based on related acyltransferases

    • Molecular dynamics simulations to predict membrane interactions

    • Deep learning-based structure prediction using AlphaFold or similar tools

  • Biochemical topology mapping:

    • Protease protection assays to identify membrane-protected regions

    • Chemical labeling of accessible residues combined with mass spectrometry

    • Fluorescence resonance energy transfer (FRET) to measure intramolecular distances

  • In vivo approaches:

    • GFP-fusion analysis to determine cellular localization

    • Complementation studies in model organisms lacking endogenous plsY

    • Protein-protein interaction studies to identify potential regulatory partners

These complementary approaches can provide critical insights into how plsY's structure enables its function in membrane lipid biosynthesis across diverse Prochlorococcus strains .

How can recombinant plsY be utilized in synthetic biology applications?

Recombinant plsY offers several promising applications in synthetic biology:

  • Engineered lipid production systems:

    • Incorporation into synthetic pathways for producing specialized membrane lipids

    • Modification of fatty acid compositions in industrial microorganisms

    • Creation of artificial membranes with novel properties

  • Heterologous expression in diverse hosts:

    • Integration into cyanobacterial species for enhanced photosynthetic efficiency

    • Expression in E. coli or yeast as platform organisms for lipid production

    • Potential for expression in plants to modify glycerolipid biosynthesis

  • Enzyme engineering approaches:

    • Directed evolution to generate plsY variants with modified substrate specificities

    • Rational design of chimeric enzymes combining domains from different sources

    • Creation of fusion proteins linking plsY with other lipid biosynthetic enzymes for enhanced pathway efficiency

  • Application in biofuel production:

    • Engineering of plsY to increase flux toward lipid precursors suitable for biofuel production

    • Incorporation into synthetic pathways designed for targeted production of specific lipid profiles

    • Potential role in converting photosynthetic organisms into more efficient biofuel producers

  • Membrane engineering:

    • Modification of membrane composition in host organisms to enhance stress tolerance

    • Alteration of membrane properties to optimize for industrial processes

    • Creation of specialized membrane domains for biotechnological applications

These applications leverage the fundamental role of plsY in glycerolipid biosynthesis while exploiting the natural diversity of this enzyme across Prochlorococcus strains to expand the toolkit for synthetic biology approaches .

How does plsY compare functionally with PlsC and what are the implications for lipid biosynthesis pathways?

The functional comparison between plsY and PlsC reveals distinct but complementary roles in lipid biosynthesis:

FeatureplsYPlsC
Reaction catalyzedAcylation of glycerol-3-phosphate at sn-1 positionAcylation of lysophosphatidic acid at sn-2 position
Substrate specificityUses acyl-phosphate as acyl donorPrimarily uses acyl-CoA or acyl-ACP as acyl donor
Position in pathwayCatalyzes first step in phosphatidic acid synthesisCatalyzes second step in phosphatidic acid synthesis
Membrane associationIntegral membrane proteinIntegral membrane protein
Purification challengesDifficult to solubilize without inactivationDifficult to solubilize without inactivation
Evolutionary distributionPresent in prokaryotesPresent in both prokaryotes and eukaryotes

Key implications for lipid biosynthesis pathways:

  • Sequential action: plsY and PlsC act sequentially in the de novo phosphatidic acid synthesis pathway, with plsY creating the substrate for PlsC .

  • Rate-limiting considerations: The relative activities of these enzymes can influence the flux through the phospholipid biosynthesis pathway and potentially affect membrane composition .

  • Substrate preferences: In some organisms, different PlsC variants show preferences for specific acyl-CoA donors, such as polyunsaturated fatty acyl groups, potentially leading to distinct membrane lipid compositions .

  • Regulatory points: Both enzymes represent potential regulatory points for modulating membrane lipid synthesis in response to environmental conditions .

  • Evolutionary significance: The distribution and sequence conservation patterns of these enzymes across different organisms provide insights into the evolution of lipid biosynthesis pathways .

What are the key differences between prokaryotic plsY from Prochlorococcus and eukaryotic GPAT enzymes?

The key differences between prokaryotic plsY from Prochlorococcus and eukaryotic GPAT enzymes reveal fundamental distinctions in lipid biosynthesis strategies:

  • Subcellular localization:

    • Prokaryotic plsY: Integrated in the cell membrane

    • Eukaryotic GPATs: Distributed across multiple organelles (plastid, endoplasmic reticulum, mitochondria)

  • Structural organization:

    • Prokaryotic plsY: Typically smaller (197-206 amino acids), single-domain proteins

    • Eukaryotic GPATs: Generally larger with additional regulatory domains and complex membrane topology

  • Substrate preferences:

    • Prokaryotic plsY: Utilizes acyl-phosphate as the acyl donor

    • Eukaryotic GPATs: Predominantly utilize acyl-CoA as the acyl donor

  • Stereospecificity:

    • Prokaryotic plsY: Primarily catalyzes sn-1 acylation

    • Eukaryotic GPATs: Some variants can catalyze both sn-1 and sn-2 acylation, particularly with certain substrates like dicarboxylic acid-CoA

  • Physiological roles:

    • Prokaryotic plsY: Focused on membrane phospholipid synthesis

    • Eukaryotic GPATs: Involved in diverse processes including membrane lipid synthesis, storage lipid formation, and extracellular lipid polyester biosynthesis

  • Regulation mechanisms:

    • Prokaryotic plsY: Primarily regulated at transcriptional level in response to environmental conditions

    • Eukaryotic GPATs: Subject to complex post-translational modifications and protein-protein interactions

These differences reflect the distinct evolutionary trajectories and metabolic requirements of prokaryotic versus eukaryotic organisms, with important implications for understanding and manipulating lipid biosynthesis across biological systems .

How have comparative genomic approaches contributed to our understanding of plsY evolution across marine cyanobacteria?

Comparative genomic approaches have significantly advanced our understanding of plsY evolution across marine cyanobacteria:

  • Phylogenetic incongruence detection:

    • Analysis of plsY gene phylogenies compared to 16S rRNA trees has revealed instances of horizontal gene transfer (HGT) between Prochlorococcus and Synechococcus lineages

    • Bipartition analyses have identified approximately 9.3% of core genes, including those involved in lipid metabolism, as having histories influenced by HGT

  • Ecotype-specific adaptation patterns:

    • Comparisons of plsY sequences across high-light and low-light adapted ecotypes reveal distinctive evolutionary signatures

    • Low-light adapted ecotypes with larger genomes (e.g., MIT 9313, NATL strains) show evidence of more complex evolutionary histories

  • Identification of genomic islands:

    • Whole-genome analyses have mapped lipid metabolism genes, including plsY variants, to genomic islands in some strains

    • These genomic islands often harbor genes that deviate from the core phylogenetic signal, suggesting acquisition through HGT

  • Microdiversity assessment:

    • Deep sequencing approaches analyzing plsY diversity within natural populations have revealed extensive microdiversity

    • Studies in the Mediterranean Sea have shown that there are "virtually no identical sequences" in pcb gene libraries from the same population, suggesting similar patterns may exist for metabolic genes like plsY

  • Mosaic evolutionary patterns:

    • Analysis of 18 genomes of P. marinus and marine Synechococcus revealed complex and mosaic phylogenetic histories for many metabolic genes

    • These patterns suggest that lipid biosynthesis pathways have been shaped by both vertical inheritance and cross-species gene acquisition

This comparative genomic evidence collectively points to plsY evolution being driven by a combination of adaptive selection pressures and gene flow across marine cyanobacterial populations, contributing to the remarkable ecological success of Prochlorococcus in diverse oceanic environments .

What are the current limitations in studying plsY function and how might they be overcome?

Current limitations in studying plsY function and potential solutions include:

  • Membrane protein solubilization challenges:

    • Limitation: plsY is an integral membrane protein that is difficult to solubilize without loss of activity

    • Solution: Novel detergents such as 6-cyclohexyl-1-hexyl-β-d-maltoside have shown promise for solubilizing similar acyltransferases while maintaining activity

  • Lack of high-resolution structural data:

    • Limitation: No crystal or cryo-EM structures are currently available for plsY from Prochlorococcus

    • Solution: Application of advanced structural biology techniques optimized for membrane proteins, including lipid cubic phase crystallization or antibody-mediated crystallization approaches

  • Functional redundancy in model systems:

    • Limitation: Knockout studies in model organisms may be complicated by functional redundancy with other acyltransferases

    • Solution: Development of conditional expression systems or precisely targeted mutations affecting catalytic activity without disrupting protein-protein interactions

  • Limited in vivo assessment tools:

    • Limitation: Tools for studying plsY function in native Prochlorococcus are underdeveloped

    • Solution: Adaptation of genetic systems from related cyanobacteria or development of heterologous expression systems that mimic native cellular environments

  • Substrate specificity characterization:

    • Limitation: Comprehensive analysis of substrate preferences across different plsY variants is lacking

    • Solution: Development of high-throughput screening methods using synthetic substrate libraries coupled with sensitive detection methods

  • Physiological relevance of in vitro observations:

    • Limitation: In vitro enzymatic characteristics may not reflect in vivo function

    • Solution: Integration of lipidomics approaches to correlate enzyme activities with cellular lipid profiles under varied conditions

Addressing these limitations will require interdisciplinary approaches combining advanced biochemical techniques, structural biology, synthetic biology, and systems biology to fully elucidate the function and regulation of plsY in Prochlorococcus .

What emerging technologies might enable new insights into plsY structure and function?

Several emerging technologies hold promise for advancing our understanding of plsY structure and function:

  • Cryo-electron microscopy advances:

    • Single-particle cryo-EM with improved detectors and processing algorithms now enables structural determination of smaller membrane proteins

    • Cryo-electron tomography could reveal plsY organization within native membrane environments

  • Integrative structural biology approaches:

    • Combining X-ray crystallography, NMR, mass spectrometry, and computational modeling

    • Cross-linking mass spectrometry to map protein-protein interactions and conformational states

  • Native mass spectrometry:

    • Analysis of intact membrane protein complexes to identify interaction partners

    • Characterization of lipid-protein interactions that may regulate enzyme function

  • Single-molecule techniques:

    • Fluorescence resonance energy transfer (FRET) to monitor conformational changes during catalysis

    • Single-molecule force spectroscopy to analyze membrane protein folding and stability

  • Advanced genetic tools:

    • CRISPR-Cas9 systems adapted for cyanobacterial editing

    • Inducible degradation systems for temporal control of protein function

    • Base editing technologies for precise amino acid substitutions

  • Artificial intelligence applications:

    • Deep learning for improved protein structure prediction (e.g., AlphaFold)

    • Machine learning approaches to identify patterns in sequence-function relationships

    • Computational design of modified enzymes with altered properties

  • Nanodiscs and lipid bilayer technologies:

    • Reconstitution of plsY in defined lipid environments to assess lipid-dependent activity

    • High-throughput platforms for screening enzyme activity in membrane-mimetic systems

These technologies, particularly when applied in combination, have the potential to overcome current limitations and provide unprecedented insights into plsY structure, dynamics, and function within the cellular context .

How might understanding plsY contribute to broader ecological studies of Prochlorococcus in marine environments?

Understanding plsY function can significantly enhance our comprehension of Prochlorococcus ecology in marine environments through several interconnected research avenues:

  • Membrane adaptation mechanisms:

    • plsY sequence variations across ecotypes may reflect adaptations to different temperature, pressure, and nutrient conditions at various ocean depths

    • Membrane lipid composition differences, influenced by plsY activity, likely contribute to the remarkable ecological success of Prochlorococcus across diverse oceanic regions

  • Biomarker development:

    • plsY sequence variations could serve as genetic markers for tracking specific Prochlorococcus ecotypes in environmental samples

    • Lipid profiles resulting from distinctive plsY activities might function as chemotaxonomic markers in oceanographic studies

  • Evolutionary insights:

    • Comparative analyses of plsY across marine cyanobacteria provide evidence of genomic islands and horizontal gene transfer

    • These patterns reveal mechanisms of adaptive evolution in response to environmental pressures in the world's oceans

  • Climate change response prediction:

    • Understanding how plsY variants contribute to membrane adaptation could help predict how different Prochlorococcus ecotypes might respond to changing ocean temperatures and acidification

    • This knowledge is crucial given that Prochlorococcus is responsible for a significant portion of global oceanic primary production

  • Microbial community interactions:

    • Distinctive membrane properties influenced by plsY might affect interactions with viruses, predators, and symbiotic partners

    • These interactions shape marine microbial community structure and function

  • Nutrient cycling implications:

    • Membrane lipid composition affects cell lysis rates and subsequent nutrient release

    • plsY function thus indirectly influences marine phosphorus and carbon cycling

By connecting molecular-level understanding of plsY function to ecosystem-level processes, researchers can develop more sophisticated models of how Prochlorococcus populations respond to and influence marine environments, with implications for global biogeochemical cycles and ocean productivity .

What are the most significant recent advances in understanding Prochlorococcus marinus plsY?

Recent significant advances in understanding Prochlorococcus marinus plsY include:

  • Successful recombinant expression strategies:

    • Development of reliable protocols for expressing functional plsY from multiple Prochlorococcus strains in E. coli

    • Application of His-tag fusion approaches for improved purification yields

  • Comparative genomic insights:

    • Identification of ecotype-specific variations in plsY sequences correlating with ecological adaptations

    • Discovery of unexpected microdiversity within populations, suggesting ongoing evolutionary processes

  • Functional characterization:

    • Improved understanding of plsY's role in glycerophospholipid biosynthesis pathways

    • Recognition of its importance in membrane adaptation to various environmental conditions

  • Methodological breakthroughs:

    • Development of improved detergent systems for solubilizing membrane-bound acyltransferases without activity loss

    • New assay systems for evaluating enzymatic activity under various conditions

  • Evolutionary context:

    • Integration of plsY sequence data into broader understanding of Prochlorococcus genome evolution

    • Evidence for horizontal gene transfer events shaping lipid metabolism pathways

These advances collectively provide a more comprehensive understanding of plsY's biochemical properties, evolutionary history, and ecological significance within the globally important marine cyanobacterium Prochlorococcus marinus .

How does research on plsY contribute to our understanding of fundamental biological processes?

Research on Prochlorococcus marinus plsY contributes significantly to our understanding of fundamental biological processes through several key insights:

  • Membrane lipid biosynthesis regulation:

    • plsY represents a critical control point in phospholipid synthesis

    • Its study reveals mechanisms governing membrane composition adaptation in response to environmental changes

  • Enzyme evolution across diverse environments:

    • Comparison of plsY sequences across Prochlorococcus ecotypes reveals how protein function adapts to different selective pressures

    • This provides a model system for studying molecular adaptation in context of ecological specialization

  • Membrane protein structure-function relationships:

    • As an integral membrane protein, plsY studies advance our understanding of how these challenging proteins function within lipid bilayers

    • This contributes to broader knowledge of membrane protein biochemistry

  • Minimal genome strategies:

    • Prochlorococcus represents a model for genome streamlining, and understanding essential processes like those catalyzed by plsY illuminates the minimal requirements for cellular life

    • This has implications for synthetic biology and origins of life research

  • Prokaryotic-eukaryotic divergence in lipid metabolism:

    • Comparison of prokaryotic plsY with eukaryotic GPAT enzymes reveals fundamental differences in lipid metabolism strategies

    • This contributes to our understanding of the evolution of complex cellular systems

  • Horizontal gene transfer mechanisms:

    • Evidence of plsY transfer between marine cyanobacterial lineages provides insights into microbial genome evolution

    • This enhances our understanding of how genetic innovation spreads in microbial communities

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.