Recombinant Prochlorococcus marinus Membrane protein insertase YidC (yidC)

Shipped with Ice Packs
In Stock

Description

Introduction to YidC and Its Role in Membrane Protein Biogenesis

YidC is a universally conserved membrane insertase critical for the integration, folding, and assembly of membrane proteins across all domains of life . In bacteria, YidC operates either independently or in concert with the Sec translocon to mediate co-translational and post-translational insertion of substrates into lipid bilayers . The Prochlorococcus marinus YidC homolog shares structural and functional conservation with Escherichia coli YidC, enabling its recombinant production for mechanistic studies .

2.1. Genomic Context and Conservation

Prochlorococcus marinus has a streamlined genome (1.6–2.6 Mbp) adapted to oligotrophic marine environments . Its YidC homolog is essential for integrating photosynthetic and respiratory membrane proteins, critical for survival under fluctuating light and nutrient conditions . Comparative genomics reveals high sequence conservation in the transmembrane (TM) domains and hydrophilic groove, key for substrate recognition .

2.2. Role in Photosynthetic Machinery

YidC facilitates the insertion of:

  • Photosystem II (PSII) subunits: Vital for light-driven electron transport .

  • Cytochrome complexes: Required for oxidative phosphorylation .

  • Stress-response transporters: Critical for nutrient uptake in nutrient-poor environments .

3.1. Domain Architecture

The Prochlorococcus marinus YidC structure (inferred from E. coli homologs ) includes:

DomainFunction
Transmembrane domains (TM1–TM5)Anchor YidC into the lipid bilayer and form a hydrophilic groove .
Cytoplasmic helical hairpin (TM2–TM3)Binds ribosomes during co-translational insertion .
Conserved arginine residue (R72)Stabilizes substrate interactions via salt bridges .

4.1. Expression Systems

Recombinant Prochlorococcus marinus YidC is typically produced in E. coli heterologous systems due to its genetic tractability . Key steps include:

  1. Gene cloning: Amplification of yidC from P. marinus genomes (e.g., MED4, MIT9313) .

  2. Membrane extraction: Detergent solubilization (e.g., DDM, LMNG) for purification .

  3. Proteoliposome reconstitution: Incorporation into lipid bilayers for functional assays .

4.2. Functional Validation

AssayFindingsReference
Substrate insertion kinetics150 Pf3 coat proteins inserted per YidC molecule in 20 minutes .
Salt-bridge mutagenesisR72A mutation reduces insertion efficiency by >70% .
Energy dependenceOperates independently of ATP or Sec translocon in P. marinus .

Comparative Analysis with Other YidC Homologs

FeatureProchlorococcus marinus YidCE. coli YidC
Substrate specificityPSII subunits, transportersPhage coat proteins, ATP synthase
Dependence on Sec transloconSec-independent (low-light strains) Sec-independent or collaborative
Structural RMSD2.0–4.0 Å (simulated) 1.8–3.5 Å (experimental)

Applications and Research Implications

  1. Biotechnological tool: Enables membrane protein engineering for synthetic biology .

  2. Environmental adaptation: Insights into P. marinus survival in expanding ocean Oxygen Minimum Zones (OMZs) .

  3. Drug discovery: Targeting YidC could disrupt bacterial membrane biogenesis .

Challenges and Future Directions

  • Structural resolution: Cryo-EM studies are needed to resolve P. marinus YidC-substrate complexes .

  • Ecotype variability: LL (low-light) vs. HL (high-light) ecotypes may exhibit distinct YidC regulatory mechanisms .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order. We will prepare the protein according to your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributor for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by several factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
yidC; Pro_1302; Membrane protein insertase YidC; Foldase YidC; Membrane integrase YidC; Membrane protein YidC
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-382
Protein Length
full length protein
Species
Prochlorococcus marinus (strain SARG / CCMP1375 / SS120)
Target Names
yidC
Target Protein Sequence
MIGFLSDNLLIPILDFFYGLFHSYGIAIVALTIVIRIALFPLSAGSIRSARRMKIAQPVM QKRQAEIKSRYANDPKKQQDELGKLMGEFGSPLAGCLPLLVQMPILFALFATLRGSPFAD VPYLVNLKILPPEQIAAVEPKPFKSPRHSIFISDKDHFPVIASLPGGTKIAAGDSVNIKL ETLSGEKYSNVLGKFENGSKFSPTWKLTKGADLASVSADGTVTAKYPGDATVEGKIPGLA AKSGFLFIKALGQVGFYVDGAINWDIAILVAGFGLTLVISQVLSGQGMPPNPQQATAQKI TPIMITGMFLFFPLPAGVLLYMVIANMFQAFQTFLLNKEALPENLQKILDDQIKNQGKKE LATSPAIDSERLPFEPKSNKQN
Uniprot No.

Target Background

Function
Essential for the insertion and/or proper folding and/or complex formation of integral membrane proteins into the membrane. Involved in the integration of membrane proteins that insert both dependently and independently of the Sec translocase complex, as well as at least some lipoproteins. Aids in the folding of multispanning membrane proteins. It is also likely to facilitate protein insertion, folding, and/or assembly of membrane complexes destined for the thylakoid.
Database Links
Protein Families
OXA1/ALB3/YidC family, Type 1 subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Prochlorococcus marinus YidC and how does it compare to other bacterial YidC proteins?

YidC is a membrane protein insertase that catalyzes the integration of newly synthesized proteins into the prokaryotic plasma membrane. In Prochlorococcus marinus, YidC likely shares the conserved functional domains found in other bacterial YidC proteins, particularly the groove-like structure at the protein-lipid interface that allows transmembrane segments to slide into the lipid bilayer .

Unlike the Sec translocase which operates as a transmembrane channel, YidC functions at an amphiphilic interface, providing a more direct pathway for membrane protein insertion . Given Prochlorococcus's minimal genome and adaptation to nutrient-poor environments, its YidC likely plays a crucial role in maintaining the specialized photosynthetic apparatus that contains unique divinyl chlorophyll derivatives (Chl a₂ and Chl b₂) .

What methodologies are appropriate for purifying functional Prochlorococcus marinus YidC?

Successful purification of functional YidC requires:

  • Expression system selection: E. coli expression systems using C41(DE3) or C43(DE3) strains designed for membrane protein expression are recommended.

  • Membrane extraction: Gentle solubilization using mild detergents such as DDM (n-dodecyl β-D-maltoside) preserves protein structure and function.

  • Purification strategy: The protocol developed for E. coli YidC can be adapted, which typically involves:

    • Affinity chromatography using histidine tags

    • Size exclusion chromatography to ensure homogeneity

    • Optional ion-exchange chromatography for higher purity

  • Functional reconstitution: Reconstitution into proteoliposomes for functional assays, similar to methods used for E. coli YidC .

The success of the purification can be verified by testing the ability of the reconstituted YidC to insert model substrate proteins like Pf3 coat protein into liposomes .

How can researchers determine if a membrane protein is a substrate for Prochlorococcus marinus YidC?

Researchers can employ several complementary approaches:

  • In vitro reconstitution assays: Purified YidC reconstituted into proteoliposomes can be tested for its ability to insert candidate substrate proteins. Successful insertion can be monitored by protease protection assays, as demonstrated with E. coli YidC and Pf3 coat protein .

  • Comparative insertion kinetics: Compare the rate and efficiency of insertion in YidC-containing versus YidC-free liposomes. Even proteins capable of spontaneous insertion may show accelerated insertion in the presence of YidC, as observed with mutant Pf3 coat protein containing an extended hydrophobic region .

  • Cross-linking studies: Chemical cross-linking can capture transient interactions between YidC and potential substrate proteins during the insertion process.

  • YidC depletion effects: In genetic systems, depletion of YidC followed by proteomics analysis can identify accumulated substrate proteins that depend on YidC for proper membrane integration.

How does the membrane insertion mechanism of YidC differ between Prochlorococcus ecotypes adapted to different ocean depths?

Prochlorococcus marinus exists as genetically distinct ecotypes adapted to different ocean depths, with significant variations in their photosynthetic apparatus and membrane protein composition:

EcotypeOcean DepthChl b₂/Chl a₂ RatioPhotosynthetic Characteristics
Surface (e.g., MED4)0-100m~0.13Lower pigment content, adapted to high light
Deep (e.g., SARG/SS120)80-200m>1.0Higher pigment content, adapted to low light
MIT9303/MIT9313Deep>1.1Specialized low-light photosystems

The YidC proteins from these ecotypes likely exhibit adaptations specific to their environmental niches:

  • Substrate specificity: Surface ecotype YidC may be optimized for inserting high-light adapted photosystem proteins, while deep ecotype YidC might specialize in inserting the distinct membrane proteins required for low-light photosynthesis .

  • Functional efficiency: The varying Chl b₂ content (0.1 to 4.5 fg cell⁻¹) and Chl a₂ content (0.23 to 2.7 fg cell⁻¹) across depths suggests different membrane protein compositions that would require adapted YidC functionality .

  • Environmental adaptations: Temperature and pressure gradients at different depths may have selected for YidC variants with optimized functionality under specific conditions.

Research methodologies to investigate these differences include comparative structural analysis, heterologous expression of YidC variants from different ecotypes, and functional reconstitution assays under varying conditions that mimic their natural environments.

Can Prochlorococcus marinus YidC function independently of the Sec translocase, and what experimental approaches can test this?

Evidence from E. coli YidC suggests that YidC can function independently of the Sec translocase for certain substrates . To investigate whether Prochlorococcus marinus YidC exhibits similar independence:

Experimental approach 1: In vitro reconstitution

  • Purify Prochlorococcus YidC and reconstitute into proteoliposomes without Sec components

  • Test insertion of model substrates known to use YidC-only or Sec-YidC pathways in other organisms

  • Compare insertion efficiency between:

    • YidC-only proteoliposomes

    • YidC+SecYEG proteoliposomes

    • Control liposomes without insertion machinery

Experimental approach 2: Substrate specificity analysis

  • Use the mutant Pf3 coat protein with extended hydrophobic region as a model

  • Compare insertion kinetics with and without YidC

  • Examine whether YidC accelerates insertion even for substrates capable of spontaneous insertion

Experimental approach 3: Structural-functional analysis

  • Identify the interaction sites between YidC and the Sec translocase through computational modeling

  • Generate YidC variants with mutations at potential Sec interaction sites

  • Test whether these mutations affect Sec-dependent insertion while preserving Sec-independent functions

Current evidence suggests that YidC can form an ion-conducting pore , which may provide a pathway for charge translocation during protein insertion independent of the Sec system.

What role does YidC play in the assembly of the unique photosynthetic apparatus in Prochlorococcus marinus?

Prochlorococcus marinus possesses a distinctive photosynthetic apparatus characterized by divinyl chlorophylls (Chl a₂ and Chl b₂) with ratios that vary dramatically with ocean depth . YidC likely plays a crucial role in assembling this specialized machinery:

Photosynthetic performance and YidC function:

ParameterSurface Ecotype (MED)Deep Ecotype (SARG)Relationship to YidC Function
Chl b₂/Chl a₂ ratio0.13>1.0YidC may insert different antenna proteins
Assimilation rates (fg C fg Chl⁻¹ h⁻¹)1.5-4.81.4-5.6Efficiency of photosynthetic complex assembly
P^Chl at low lightLowerHigherIntegration of ecotype-specific photosystems

YidC likely contributes to photosynthetic apparatus assembly through:

  • Integration of core photosystem proteins: Inserting the transmembrane helices of photosystem I and II components, which must be precisely positioned for electron transfer.

  • Assembly of light-harvesting complexes: The dramatic variation in pigment ratios suggests different antenna systems that would require specialized membrane protein integration by YidC.

  • Coordination with chlorophyll synthesis: Proper timing of membrane protein insertion may be coordinated with pigment synthesis to ensure efficient assembly of functional complexes.

Research strategies could include comparing YidC-dependent insertion of photosynthetic apparatus proteins between ecotypes and correlating YidC expression with photosynthetic complex assembly under different light conditions.

How does the structure-function relationship of YidC support the minimal genome strategy of Prochlorococcus marinus?

Prochlorococcus marinus has one of the smallest genomes among photosynthetic organisms, reflecting its adaptation to nutrient-limited oceanic environments. YidC's structure-function characteristics likely support this minimal genome strategy in several ways:

  • Dual functionality: YidC can operate both independently and in conjunction with the Sec translocase , potentially reducing the need for multiple specialized insertion systems.

  • Efficient protein insertion: The groove-like structure at an amphiphilic protein-lipid interface provides an energetically favorable pathway for membrane protein integration , minimizing the energy requirements for membrane protein biogenesis.

  • Adaptability to diverse substrates: YidC's ability to handle various substrate proteins allows for efficient utilization of a single insertase for multiple membrane protein types, eliminating the need for specialized insertases for different protein classes.

  • Integration with translation: YidC likely directly interacts with ribosomes for co-translational insertion, similar to E. coli YidC, streamlining the protein synthesis-insertion pathway without requiring additional factors.

Experimental approaches to investigate this relationship could include:

  • Comparative genomic analysis of YidC and protein insertion machinery across Prochlorococcus ecotypes

  • Assessment of YidC substrate range in Prochlorococcus compared to organisms with larger genomes

  • Functional complementation tests to determine if Prochlorococcus YidC can replace multiple insertion factors in other organisms

What are the recommended approaches for studying YidC-substrate interactions in Prochlorococcus marinus?

Researchers can employ several complementary methodologies to investigate YidC-substrate interactions:

In vitro approaches:

  • Reconstitution systems: Purified YidC reconstituted into liposomes can be used to study insertion of model substrates, similar to the successful approach with E. coli YidC and Pf3 coat protein .

  • Protease protection assays: After reconstitution experiments, protease treatment can determine the topology of inserted proteins, confirming successful YidC-mediated insertion .

  • Site-specific crosslinking: Introduction of photo-activatable amino acids at specific positions in YidC can capture transient interactions with substrates during the insertion process.

In vivo approaches:

  • Heterologous expression systems: Expression of Prochlorococcus YidC in E. coli YidC-depletion strains can test complementation ability and substrate specificity.

  • Fluorescence microscopy: Using fluorescently tagged YidC and substrate proteins to visualize interactions in living cells.

  • Co-immunoprecipitation: To identify natural substrate proteins in Prochlorococcus or heterologous systems.

Structural approaches:

  • Cryo-electron microscopy: To visualize YidC-substrate complexes at different stages of insertion.

  • Hydrogen-deuterium exchange mass spectrometry: To map interaction interfaces between YidC and substrate proteins.

The observed orientation of reconstituted YidC in proteoliposomes, with the periplasmic region inside (as evidenced by the appearance of a trypsin-resistant 42 kDa fragment), provides a useful experimental system for studying insertion mechanisms .

How can researchers accurately measure the efficiency and kinetics of YidC-mediated membrane protein insertion?

To quantitatively assess YidC-mediated insertion efficiency and kinetics:

Quantitative insertion assays:

  • Time-course protease protection assays: Measure the rate of substrate protection from externally added proteases as they become inserted into reconstituted proteoliposomes containing YidC .

  • Fluorescence-based assays: Use fluorescently labeled substrates with environmentally sensitive fluorophores that change emission properties upon membrane insertion.

  • Comparative insertion rates: Compare insertion efficiency between:

    • Wild-type YidC

    • YidC mutants with altered functional properties

    • YidC-free controls to assess spontaneous insertion

Data analysis approaches:

ParameterMeasurement MethodSignificance
Insertion rate (k<sub>ins</sub>)Time-course of protected fragmentsKinetic efficiency of YidC
Maximum insertion (I<sub>max</sub>)Plateau of protected substrateCapacity of YidC-mediated insertion
Substrate specificityComparison across different substratesPreference for certain protein features

When designing these experiments, researchers should consider that even proteins capable of spontaneous insertion, like the mutant Pf3 coat protein with extended hydrophobic regions, may show accelerated insertion in the presence of YidC, indicating a catalytic role beyond mere facilitation .

What are the critical controls and potential pitfalls when working with recombinant Prochlorococcus marinus YidC?

When working with recombinant Prochlorococcus marinus YidC, researchers should be aware of these critical considerations:

Essential controls:

  • Functional validation: Verify that purified and reconstituted YidC retains its insertion activity using established model substrates like Pf3 coat protein .

  • Orientation controls: Confirm the orientation of YidC in proteoliposomes using protease protection assays, looking for the characteristic trypsin-resistant 42 kDa periplasmic domain fragment observed with E. coli YidC .

  • Substrate-only controls: Always include liposomes without YidC to assess the level of spontaneous insertion, particularly important since some hydrophobic proteins can insert independently but may be accelerated by YidC .

Common pitfalls and solutions:

Potential IssueIndicatorsSolutions
Inactive proteinPoor insertion of model substratesOptimize purification conditions; use gentle detergents
Incorrect orientationAbsence of expected protease-resistant fragmentsAdjust reconstitution protocol; try different lipid compositions
AggregationSize exclusion profiles showing high molecular weight speciesInclude stabilizing agents; optimize detergent:protein ratio
Non-specific effectsSimilar insertion in YidC and control liposomesVerify YidC functionality with known YidC-dependent substrates

Methodological refinements:

  • The inclusion of a membrane potential (ΔΨ) in functional assays may be critical, as it has been shown to enhance Pf3 coat insertion into membrane vesicles .

  • For orientation analysis, researchers should look for the appearance of the trypsin-resistant fragment of approximately 42 kDa that represents the protected periplasmic domain, similar to what has been observed with E. coli YidC in inverted membrane vesicles .

How should researchers interpret contradictory results between in vivo and in vitro studies of Prochlorococcus marinus YidC?

When faced with discrepancies between in vivo and in vitro findings regarding Prochlorococcus marinus YidC function, researchers should consider:

Sources of potential contradictions:

  • Environmental differences: The natural environment of Prochlorococcus (oligotrophic ocean conditions) differs significantly from laboratory conditions, affecting protein function.

  • Membrane composition effects: Lipid composition in artificial systems may not accurately reflect the specialized membrane environment of Prochlorococcus.

  • Missing cofactors: In vitro systems may lack critical cofactors or auxiliary proteins present in vivo.

  • Strain-specific variations: Different Prochlorococcus ecotypes show substantial physiological differences that could affect YidC function .

Reconciliation strategies:

  • Systematically vary conditions: Adjust reconstitution conditions to better mimic the native environment of Prochlorococcus, including:

    • Lipid composition reflecting Prochlorococcus membranes

    • Ion concentrations matching oceanic conditions

    • Temperature ranges relevant to the organism's natural habitat

  • Bridge the methodological gap: Use complementary approaches such as:

    • Spheroplast systems that maintain cellular components while allowing substrate accessibility

    • Semi-permeabilized cell assays that preserve cellular integrity

    • Heterologous expression in related cyanobacteria rather than E. coli

  • Consider ecotype diversity: Compare YidC function across different Prochlorococcus ecotypes to account for natural variations in protein function related to adaptation to different ocean depths .

What are the implications of Prochlorococcus marinus YidC research for understanding membrane protein evolution in minimal genomes?

Research on Prochlorococcus marinus YidC provides valuable insights into membrane protein evolution in organisms with minimal genomes:

Evolutionary insights:

  • Functional conservation: The basic mechanism of YidC appears conserved across diverse organisms, suggesting fundamental constraints on membrane protein insertion mechanisms .

  • Adaptive specialization: Prochlorococcus has optimized its cellular machinery for survival in oligotrophic environments, potentially leading to specialized features in YidC function.

  • Genome streamlining: With one of the smallest genomes among photosynthetic organisms, Prochlorococcus represents an example of genome minimization while maintaining complex functions like photosynthesis.

Broader implications for membrane protein evolution:

Evolutionary AspectProchlorococcus YidC FeatureSignificance
Minimal functional requirementsCore structural elements preservedIdentifies essential components of insertion machinery
Ecological adaptationPotential ecotype-specific variationsReveals how environmental pressures shape insertase function
Ancient protein machineryConserved across bacteria, archaea, mitochondria, chloroplastsProvides insight into evolutionarily stable mechanisms

This research contributes to understanding:

  • The minimal requirements for membrane protein insertion in cells

  • How photosynthetic organisms adapt their membrane protein biogenesis to specific light environments

  • The evolutionary trajectory of membrane insertases in organisms under strong selective pressure for genome minimization

How can findings from Prochlorococcus marinus YidC research inform broader studies of photosynthetic membrane biogenesis?

Research on Prochlorococcus marinus YidC offers unique perspectives on photosynthetic membrane biogenesis due to this organism's distinctive characteristics:

Unique aspects of Prochlorococcus photosynthetic apparatus:

  • Specialized pigments: Contains divinyl derivatives of chlorophyll (Chl a₂ and Chl b₂) rather than the standard chlorophylls .

  • Dramatic adaptation to light gradients: Ecotypes show Chl b₂/Chl a₂ ratios ranging from 0.15 in surface waters to 2.9 below the deep chlorophyll maximum .

  • Highly efficient light harvesting: Despite minimal genome and cell size, achieves efficient photosynthesis in low-nutrient environments.

Applications to broader photosynthetic membrane research:

  • Minimal photosynthetic apparatus: Understanding how YidC contributes to assembling a minimal yet functional photosynthetic system can reveal the core requirements for photosynthetic membrane biogenesis.

  • Environmental adaptation mechanisms: The distinct ecotypes of Prochlorococcus provide natural experiments in adaptation to different light regimes, informing how membrane protein insertion machinery evolves with changing environmental pressures.

  • Integration with pigment synthesis: Insights into how YidC-mediated protein insertion coordinates with the synthesis and incorporation of specialized pigments like divinyl chlorophylls.

  • Efficient membrane assembly: As the most abundant photosynthetic organism on Earth , Prochlorococcus has optimized membrane assembly processes under resource limitations, potentially revealing novel efficiency mechanisms.

Researchers can apply these insights to engineering more efficient photosynthetic systems or understanding how photosynthetic organisms might adapt to changing environmental conditions, particularly in nutrient-limited ecosystems.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.