Recombinant Prochlorococcus marinus NAD (P)H-quinone oxidoreductase subunit 3 (ndhC)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our default shipping includes standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
ndhC; PMT9312_0296; NAD(PH-quinone oxidoreductase subunit 3; NAD(PH dehydrogenase subunit 3; NADH-plastoquinone oxidoreductase subunit 3; NDH-1 subunit 3; NDH-C
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-120
Protein Length
full length protein
Species
Prochlorococcus marinus (strain MIT 9312)
Target Names
ndhC
Target Protein Sequence
MFLLTGYEYFLGFLLIAAAVPILALVTNLIVAPKGRTGERKLTYESGMEPIGGAWIQFNI RYYMFALVFVIFDVETVFLYPWAVAFNRLGLLAFIEALIFIAILVIALAYAWRKGALEWS
Uniprot No.

Target Background

Function

NDH-1 facilitates electron transfer from an unidentified electron donor, through FMN and iron-sulfur (Fe-S) centers, to quinones within the respiratory and/or photosynthetic chain. In this organism, plastoquinone is believed to be the immediate electron acceptor. The enzyme couples this redox reaction to proton translocation, conserving redox energy as a proton gradient. Cyanobacterial NDH-1 also contributes to inorganic carbon concentration.

Database Links
Protein Families
Complex I subunit 3 family
Subcellular Location
Cellular thylakoid membrane; Multi-pass membrane protein.

Q&A

What is Prochlorococcus marinus and why is its ndhC protein significant in ecological research?

Prochlorococcus marinus is the smallest known photosynthetic organism (0.5-0.7 μm in diameter) and is ubiquitous in tropical and subtropical oligotrophic ocean regions. It dominates the photosynthetic biomass in these areas, producing up to 60% of ocean chlorophyll in certain regions . This tiny cyanobacterium stores approximately four gigatons of carbon annually, making it a key player in global carbon cycling .

The ndhC protein is part of the NAD(P)H-quinone oxidoreductase complex (NDH-1 or Complex I) that mediates electron transport in photosynthesis. As Prochlorococcus marinus inhabits various ocean depths with different light intensities and oxygen levels, ndhC plays a pivotal role in the organism's adaptation to these varying conditions . Current research indicates that Prochlorococcus marinus populations may expand poleward as oceans warm, making its electron transport mechanisms even more significant for global carbon sequestration .

What expression systems are most effective for producing functional recombinant ndhC?

For optimal expression of functional recombinant Prochlorococcus marinus ndhC:

  • Expression vector selection: Use E. coli expression systems with inducible promoters (T7 or similar) and N-terminal His-tag for purification .

  • Expression conditions:

    • Culture temperature: 18-30°C (lower temperatures often improve membrane protein folding)

    • Induction: 0.1-0.5 mM IPTG is typically sufficient

    • Growth medium: Rich media such as TB or 2xYT supplemented with appropriate antibiotics

    • Expression time: Extended expression (16-24 hours) at lower temperatures may yield better results for membrane proteins

  • Host strain selection: E. coli strains specifically designed for membrane protein expression (C41/C43) can significantly improve yields by reducing toxicity.

The primary challenge is obtaining correctly folded membrane protein rather than inclusion bodies, which requires careful optimization of these parameters for each laboratory setup .

What is the recommended protocol for purification and storage of recombinant ndhC?

The most effective purification strategy follows these steps:

  • Cell lysis: Use gentle methods like enzymatic lysis with lysozyme followed by mild sonication.

  • Membrane solubilization: Employ mild detergents like DDM (n-Dodecyl β-D-maltoside) or LDAO (Lauryldimethylamine-N-oxide) at concentrations just above their critical micelle concentration.

  • Purification steps:

    • IMAC (Immobilized Metal Affinity Chromatography) using Ni-NTA for His-tagged protein

    • Size exclusion chromatography to remove aggregates

    • Verify purity via SDS-PAGE (aim for >90% purity)

  • Storage recommendations:

    • Store as lyophilized powder at -20°C to -80°C

    • For reconstituted protein:

      • Add 5-50% glycerol as cryoprotectant

      • Aliquot to avoid repeated freeze-thaw cycles

      • Use Tris/PBS-based buffer with 6% trehalose at pH 8.0

      • Store working aliquots at 4°C for up to one week

This protocol preserves both structural integrity and functional activity of the protein for experimental applications.

How can recombinant ndhC be used to investigate Prochlorococcus adaptation to differing light conditions?

Prochlorococcus marinus thrives across a wide range of ocean depths with dramatically different light regimes. The species comprises multiple clades categorized as High-Light (HL) or Low-Light (LL) adapted, with only 5 out of 12 genetic clades having cultured representatives . Recombinant ndhC enables several investigative approaches:

  • Comparative functional analysis: Express and characterize ndhC proteins from different ecotypes (e.g., MED4 from 5m depth vs. SS120 from 120m depth) to identify adaptations in electron transport .

  • In vitro electron transport assays: Measure quinone reduction rates under varying light conditions that mimic different ocean depths.

  • Reconstitution experiments: Combine recombinant ndhC with other photosynthetic components to reconstruct functional electron transport chains from different ecotypes.

  • Site-directed mutagenesis: Identify specific amino acid residues responsible for different light adaptations by generating targeted mutations and testing their effects on function.

These approaches can reveal how electron transport adaptations contribute to Prochlorococcus' remarkable ability to thrive across diverse light environments, from surface waters with high irradiance to depths below 200m where blue light predominates.

What role does ndhC play in Prochlorococcus marinus' response to low oxygen conditions?

Prochlorococcus marinus populations have been discovered in regions with low dissolved oxygen concentrations, including Oxygen Minimum Zones (OMZs) . As climate change drives ocean warming, these OMZs are predicted to expand, making oxygen adaptation increasingly important. The ndhC protein may be central to this adaptation through:

  • Alternative electron transport: Under low oxygen conditions, ndhC likely participates in modified electron flow pathways that maintain energy production without requiring high oxygen concentrations.

  • Redox balancing: The NAD(P)H-quinone oxidoreductase complex helps maintain cellular redox balance under varying oxygen availability.

  • Interaction with oxygen sensors: The complex may coordinate with oxygen-sensing mechanisms to modulate photosynthetic electron transport accordingly.

Research using recombinant ndhC in controlled oxygen conditions can elucidate these mechanisms, providing insights into how this globally important photosynthetic organism might respond to expanding OMZs. Matrix experiments testing ndhC function across various oxygen concentrations, light levels, and photoperiods can model responses to future ocean conditions .

How does ndhC from Prochlorococcus marinus relate to the broader NAD(P)H:quinone oxidoreductase gene family?

Phylogenetic analysis places Prochlorococcus marinus ndhC within the ancient bacterial NQO3 subfamily of the NAD(P)H:quinone oxidoreductase gene family . This relationship reveals several important evolutionary insights:

Flavoprotein SubfamilyRepresentative MembersEvolutionary OriginFunction
Flavodoxin-1 familyNitric oxide synthasesDistinct evolutionary pathSignaling
Flavodoxin-2 familyBacterial NQO3 genesAncient bacterial originElectron transport
Flavodoxin-2 familyVertebrate NQO1, NQO2 genesDerived from bacterial NQO3Detoxification
Flavodoxin-2 familyFungal NQO4 genesDerived from bacterial NQO3Varied roles
Flavodoxin-2 familyArchaebacterial NQO5 genesAncient originElectron transport
Flavodoxin_NdrI familyRibonucleotide reductasesDistinct pathNucleotide synthesis

Unlike vertebrate NQO1 and NQO2, which evolved specialized roles in detoxification and protection against quinones , the bacterial NQO3 proteins (including Prochlorococcus ndhC) retained their primary function in energy metabolism and electron transport. This evolutionary divergence explains the functional differences between these related proteins across different domains of life .

How does ndhC function in the context of the complete photosynthetic apparatus of Prochlorococcus marinus?

The ndhC protein functions as an integrated component of Prochlorococcus' unique photosynthetic apparatus, which includes several distinguishing features:

  • Specialized pigment system: Prochlorococcus uses divinyl derivatives of chlorophyll a and b (Chl a₂ and Chl b₂), which provide efficient absorption of blue light prevalent in deep ocean waters . The electron transport chain containing ndhC must work efficiently with this specialized pigment system.

  • NDH-1 complex assembly: ndhC integrates with other NDH subunits (including ndhM and ndhI ) to form a functional complex that mediates both linear and cyclic electron flow.

  • Minimized cellular architecture: With its extremely small cell size (0.5-0.7 μm diameter) and simple structure, Prochlorococcus avoids the "package effect" or intracellular self-shading , allowing efficient light absorption. The electron transport system containing ndhC must function within this miniaturized cellular context.

  • Ecotype-specific adaptations: Different Prochlorococcus ecotypes show dramatic variations in pigment ratios (from 0.13 to >1.0 for Chl b₂/Chl a₂) , suggesting corresponding adaptations in electron transport components to optimize energy capture across different light environments.

This integration highlights how ndhC has co-evolved with other components of the photosynthetic apparatus to create highly efficient photosynthetic systems adapted to specific ocean niches.

What are the main challenges in working with recombinant ndhC and how can they be addressed?

As a membrane protein, recombinant ndhC presents several technical challenges that researchers should anticipate:

  • Expression challenges:

    • Problem: Formation of inclusion bodies rather than functional protein

    • Solution: Lower expression temperature (18°C), use specialized E. coli strains (C41/C43), and optimize induction conditions (lower IPTG concentration, longer induction time)

  • Purification difficulties:

    • Problem: Maintaining native conformation during extraction from membranes

    • Solution: Use mild detergents and avoid harsh solubilization conditions; consider native purification approaches

  • Functional assessment:

    • Problem: Verifying that purified protein retains electron transport activity

    • Solution: Develop reliable activity assays using artificial electron acceptors; consider reconstitution into liposomes to restore membrane environment

  • Stability issues:

    • Problem: Rapid degradation or aggregation during storage

    • Solution: Store as recommended with appropriate stabilizers (trehalose, glycerol); maintain proper pH (8.0) and avoid repeated freeze-thaw cycles

By anticipating these challenges and implementing appropriate solutions, researchers can significantly improve their success in working with this important but technically demanding protein.

How can researchers design experiments to assess ndhC function in the context of climate change?

Climate change will significantly alter the oceanic environments where Prochlorococcus thrives. Designing relevant experiments requires:

  • Temperature response studies:

    • Design assays that test ndhC activity across a temperature range reflecting predicted ocean warming (current +2-4°C)

    • Compare responses of ndhC from different latitudes to assess adaptation potential

  • Oxygen sensitivity assessment:

    • Create controlled microaerobic conditions that mimic expanding OMZs

    • Measure electron transport rates as a function of oxygen concentration

  • Light adaptation experiments:

    • Test ndhC function under changing photoperiods that would be experienced as Prochlorococcus populations shift poleward by ~10° latitude

    • Examine performance under different spectral compositions, especially as populations move to deeper waters to avoid warming surface temperatures

  • Viral interaction studies:

    • Investigate how viral infection (phages are known to hijack Prochlorococcus metabolism ) affects ndhC function

    • Assess potential viral alterations to carbon fixation mechanisms that involve electron transport

Such experiments provide crucial insights into how this ecologically vital organism's electron transport system might respond to changing ocean conditions, with significant implications for global carbon cycling.

What emerging technologies could advance our understanding of ndhC function in Prochlorococcus?

Several cutting-edge technologies offer promising approaches for deeper understanding of ndhC function:

  • Cryo-electron microscopy: Determine high-resolution structures of ndhC within the complete NDH-1 complex to reveal precise interaction mechanisms and functional domains.

  • Single-molecule studies: Apply techniques like FRET (Förster Resonance Energy Transfer) to observe real-time electron transfer events mediated by ndhC.

  • Synthetic biology approaches: Create minimal synthetic electron transport chains incorporating ndhC to define essential components and interactions.

  • Advanced spectroscopy: Utilize ultrafast spectroscopy to capture transient electron transport events involving ndhC and partner proteins.

  • System-level modeling: Develop computational models of Prochlorococcus' electron transport system that integrate experimental data with climate predictions to forecast global impacts.

These emerging technologies can help resolve remaining questions about how ndhC contributes to the remarkable ecological success of Prochlorococcus marinus and its critical role in global carbon cycling.

How might recombinant ndhC contribute to understanding phage-host interactions in marine environments?

Recent studies have shown that phages can hijack the metabolism of Prochlorococcus marinus, potentially altering carbon fixation . Recombinant ndhC could facilitate several innovative research approaches:

  • Phage-modified electron transport: Compare native ndhC function with performance in phage-infected cells to identify viral manipulation of electron flow.

  • Identification of viral target sites: Use recombinant ndhC in binding studies to identify specific regions targeted by phage proteins.

  • Energy diversion mechanisms: Quantify how viral infection impacts electron transport efficiency through ndhC to understand energy redirection.

  • Evolutionary arms race: Compare ndhC sequences across Prochlorococcus strains with different phage susceptibilities to identify potential resistance adaptations.

This research could reveal how viral infection impacts global carbon cycling by altering the electron transport mechanisms of Earth's most abundant photosynthetic organism.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.