Recombinant Prochlorococcus marinus Photosystem I assembly protein Ycf4 (ycf4)

Shipped with Ice Packs
In Stock

Description

Introduction

The Photosystem I (PSI) assembly protein Ycf4, encoded by the ycf4 gene, is crucial for the biogenesis of PSI, a large multi-subunit membrane protein complex that mediates light-driven electron transfer in oxygenic photosynthesis . Prochlorococcus marinus, a globally abundant marine cyanobacterium, has different ecotypes that have adapted to various light intensities in the ocean . Ycf4 is essential for PSI accumulation in Chlamydomonas reinhardtii, a green alga .

Gene and Protein Characteristics

FeatureDescription
Gene Nameycf4
Protein NamePhotosystem I assembly protein Ycf4
SpeciesProchlorococcus marinus
StrainMIT 9515
UniProt IDA2BXL9
Ordered Locus NamesP9515_13231
Expression Region1-185
Amino Acid SequenceMESNLSSFNKIEQQINGSRKISNYLIGGMLTIGGIGFILASISSYTGRDLLPLGNPSSLLFIPQGIIMGAYGVIANLLNIYLWYLVFINFGSGYNSFDKVSQSVEIKRKGLFKDIEVKLNFDEIKSVKLDISEGFNPRRRIALVLKGRKKALPLSGAGELKPLLQVEEEGARLAKFLNVNLEGLK

Function and Importance

Ycf4 is a thylakoid protein that is essential for the accumulation of PSI . Studies on Chlamydomonas reinhardtii have shown that Ycf4 is part of a large complex involved in PSI assembly . Although Ycf4 is essential for PSI assembly in green algae, it is not essential for photosynthesis in higher plants, such as tobacco, but is deficient in PSI accumulation .

Ycf4-containing Complex

Ycf4 exists in a large complex that contains other proteins . A study using tandem affinity purification (TAP)-tagged Ycf4 identified several PSI subunits, including PsaA, PsaB, PsaC, PsaD, PsaE, and PsaF, as components of the Ycf4-containing complex . The complex also contains COP2, an opsin-related protein . Electron microscopy revealed that the purified complex has large oligomeric states, with structures measuring 285 × 185 Å .

Experimental Methods and Analysis

To study the Ycf4-containing complex, researchers have used several methods:

  • Tandem Affinity Purification (TAP) Tagging: This technique involves fusing a TAP tag to the C-terminus of Ycf4 to facilitate purification of the protein complex .

  • Mass Spectrometry: Used to identify the protein components of the purified Ycf4-containing complex .

  • Immunoblotting: Used to confirm the presence of specific proteins in the complex .

  • Electron Microscopy: Used to visualize the structure of the purified complex .

  • Atomic Force Microscopy (AFM): Used to image the PSI membrane architectures of Prochlorococcus ecotypes .

Role in Photosystem I Assembly

Study OrganismYcf4 FunctionKey Findings
ChlamydomonasEssential for PSI accumulationYcf4 is part of a large complex and interacts with other biomolecules .
Tobacco (Nicotiana)Non-essential, but affects PSI accumulationycf4 knockout plants are viable but show reduced PSI levels .
Prochlorococcus marinusAssembly factor for Photosystem IDifferent ecotypes of Prochlorococcus marinus contain a variety of Pcb protein isoforms encoded within their genomes .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timelines.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can be used as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
If you require a specific tag type, please inform us; we will prioritize its development.
Synonyms
ycf4; A9601_13331; Photosystem I assembly protein Ycf4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-185
Protein Length
full length protein
Species
Prochlorococcus marinus (strain AS9601)
Target Names
ycf4
Target Protein Sequence
MNSDLTSFDKIEQKIGGSRKISNYIIGGMLTIGGIGFLLASISSYTGRDLLPLGNPSTLL FIPQGIIMGAYGVIANLLNFYLWYLVYINFGSGSNYFDKSSKSVEIKRKGLFKDVEVKLN FDEIKSVKLDISEGFNPRRRIALVLKGRKKPLPLSGAGELKPLLQVEEEGARLAKFLDVN LEGLK
Uniprot No.

Target Background

Function
Essential for the assembly of the photosystem I complex.
Database Links
Protein Families
Ycf4 family
Subcellular Location
Cellular thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the function of Ycf4 in Prochlorococcus marinus?

Ycf4 in Prochlorococcus marinus functions as an essential assembly factor for Photosystem I (PSI). It is involved in the initial assembly steps of PSI by directly mediating interactions between newly synthesized PSI polypeptides and assisting in the assembly of the PSI complex. In Prochlorococcus strains like MED4 and MIT 9313, Ycf4 is part of the genetic inventory dedicated to photosynthesis, which comprises approximately 10% of the genome (around 169 genes in the minimal genome of MED4 strain) . The protein interacts with PSI subunits including PsaA, PsaB, PsaC, PsaD, PsaE, and PsaF to create an assembly subcomplex . Studies have shown that it specifically stabilizes an intermediate subcomplex consisting of the PsaAB heterodimer and the stromal subunits PsaCDE, while facilitating the addition of the PsaF subunit to this subcomplex.

What are the most effective approaches for studying Ycf4 function in Prochlorococcus?

Studying Ycf4 function in Prochlorococcus requires a multi-faceted approach:

  • Gene knockout studies: Complete deletion of the ycf4 gene using homologous recombination techniques. This involves designing flanking sequences (e.g., ycf10 and psaI) to target and replace the ycf4 gene with a selectable marker like aadA .

  • Protein-protein interaction analysis: Co-immunoprecipitation or tandem affinity purification (TAP) tagging methods to identify Ycf4-interacting proteins. This approach has revealed that Ycf4 forms a stable complex >1500 kD containing PSI subunits .

  • Pulse-chase protein labeling: To track newly synthesized PSI polypeptides associated with the Ycf4-containing complex .

  • Electron microscopy: To visualize the purified Ycf4-containing complexes and determine their structure. Electron microscopy has revealed particles measuring 285 × 185 Å representing large oligomeric states .

  • Physiological phenotyping: Assessment of photosynthetic parameters (photosynthetic rate, chlorophyll content) in wild-type versus ycf4 mutants .

How can recombinant Ycf4 protein be effectively expressed and purified for functional studies?

For functional studies of recombinant Prochlorococcus marinus Ycf4:

  • Expression systems: E. coli is commonly used for expression, though yeast, baculovirus, and mammalian cell systems can also be employed depending on the research requirements .

  • Purification strategy:

    • Add affinity tags (His-tag is commonly used) for easier purification

    • Use column chromatography systems optimized for membrane proteins

    • Store in Tris-based buffer with 50% glycerol to maintain stability

  • Quality assessment:

    • Purity should be >85-90% as determined by SDS-PAGE

    • Western blot using anti-Ycf4 antibodies (1:1000 dilution recommended)

    • Avoid repeated freeze-thaw cycles by preparing aliquots

  • Storage considerations:

    • Store at -20°C or -80°C for extended storage

    • Working aliquots can be maintained at 4°C for up to one week

How has the Ycf4 protein evolved across marine cyanobacteria lineages?

The evolution of Ycf4 in marine cyanobacteria shows intriguing patterns:

  • Evolutionary divergence: Ycf4 has undergone significant evolutionary changes within the cyanobacterial lineage. In Prochlorococcus, the gene remains part of the "core" photosynthetic machinery despite significant genome reduction (MED4 having only 1,657,995 bp and 1,686 protein-coding genes) .

  • Strain-specific adaptations: Different Prochlorococcus ecotypes show adaptations in their photosynthetic apparatus, including ycf4:

    • High-light adapted strains (e.g., MED4) have a single pcb gene

    • Low-light adapted strains (e.g., MIT 9313) have two pcb genes

    • These differences reflect adaptation to different light environments

  • Comparison with other cyanobacteria: While essential in Chlamydomonas reinhardtii, ycf4 seems less critical in some cyanobacteria. In Synechocystis, orf184 (ycf4) mutants grew normally despite altered pigment content .

  • Legume hypermutation: In contrast to the relative conservation in marine cyanobacteria, ycf4 has undergone extreme evolution in some land plants, particularly legumes, where it shows hypermutation and in some cases has been completely lost .

What evolutionary pressures have shaped Ycf4 structure in Prochlorococcus compared to other photosynthetic organisms?

The structure of Ycf4 in Prochlorococcus has been shaped by several evolutionary pressures:

  • Genome minimization: Prochlorococcus has undergone extensive genome reduction as an adaptation to oligotrophic marine environments. Despite this reduction, ycf4 has been retained, highlighting its essential function .

  • Light adaptation: Different Prochlorococcus ecotypes have adapted to different light niches:

    • Surface water strains (high-light adapted) like MED4 have a lower G+C content despite higher UV exposure

    • Deep water strains (low-light adapted) like MIT 9313 have higher G+C content

  • Nutrient limitation: Adaptation to low-nutrient environments has driven the evolution of a minimal and efficient photosynthetic apparatus in Prochlorococcus .

  • Functional conservation: Despite sequence divergence, key functional domains of Ycf4 have been conserved, particularly those involved in protein-protein interactions with PSI components .

How do mutations in the ycf4 gene affect photosynthesis efficiency in Prochlorococcus?

Mutations in ycf4 significantly impact photosynthesis in Prochlorococcus:

  • Complete deletion effects: Complete deletion of ycf4 renders Prochlorococcus unable to grow photoautotrophically. Δycf4 plants:

    • Display a light green to yellow phenotype

    • Have structural abnormalities in chloroplasts (altered shape, size, and grana stacking)

    • Show decreased chlorophyll content (up to 99.98% reduction as plants mature)

  • Physiological impairment: Δycf4 mutants show reduced:

    • Photosynthetic rate (A)

    • Transpiration rate (E)

    • Stomatal conductance (gs)

    • Sub-stomatal CO₂ (Ci)

    • Photosynthetic photon flux density

  • Transcriptome changes: Interestingly, ycf4 deletion affects not only PSI assembly but also transcription of other genes:

    • Decreased expression of rbcL (Rubisco large subunit)

    • Reduced Light-Harvesting Complex gene expression

    • Decreased ATP Synthase (atpB and atpL) expression

This suggests Ycf4 may have additional roles beyond PSI assembly in regulating plastid gene expression.

What is the difference between partial and complete deletion of ycf4 in terms of phenotypic effects?

The difference between partial and complete ycf4 deletion reveals crucial information about protein domains:

ParameterPartial Deletion (N-terminal 93aa)Complete Deletion (All 184/191aa)
Photoautotrophic growthPossibleImpossible
PSI accumulationReduced but presentSeverely impaired
Chloroplast structureMinor changesMajor structural abnormalities
Chlorophyll contentModerately reducedSeverely reduced (up to 99.98%)
Gene expression effectsLimitedWidespread (rbcL, LHC, ATP synthase)

This comparison suggests that the C-terminal domain (91aa) of Ycf4 is critical for protein function. In-silico protein-protein interaction studies confirm that the C-terminus is important for interacting with other chloroplast proteins . This explains why partial deletion mutants (retaining the C-terminal domain) can still grow photoautotrophically while complete deletion mutants cannot.

How does the structure of Ycf4 relate to its function in photosystem I assembly?

The structure-function relationship in Ycf4 is critical to understanding its role in PSI assembly:

  • Conserved domains: Specific amino acid residues, particularly in the C-terminal region, are highly conserved across diverse photosynthetic organisms, indicating their functional importance. For instance, the arginine at position 120 (R120) is required for Ycf4 stability, as shown by site-directed mutagenesis studies in Chlamydomonas reinhardtii .

  • Membrane integration: The membrane-spanning domains of Ycf4 anchor it to the thylakoid membrane, positioning it optimally to interact with newly synthesized PSI components. This spatial organization is crucial for its role as a scaffold protein .

  • Complex formation: Electron microscopy has revealed that Ycf4 forms large complexes (>1500 kD) with dimensions of approximately 285 × 185 Å. These large structures may represent several oligomeric states that provide a scaffold for PSI assembly .

  • Interaction network: Ycf4 interacts with:

    • PSI core proteins (PsaA, PsaB)

    • Stromal subunits (PsaC, PsaD, PsaE)

    • Peripheral subunits (PsaF)

    • Other assembly factors (such as COP2 in Chlamydomonas)

This network of interactions allows Ycf4 to sequentially stabilize PSI subcomplexes during the assembly process.

What are the challenges in determining the three-dimensional structure of Ycf4 and how might they be overcome?

Determining the 3D structure of Prochlorococcus Ycf4 presents several challenges:

  • Membrane protein crystallization:

    • Challenge: Membrane proteins like Ycf4 are difficult to crystallize due to their hydrophobic regions.

    • Solution: Use of detergents or lipidic cubic phase crystallization methods optimized for membrane proteins.

  • Protein stability:

    • Challenge: Ycf4 may have unstable regions or conformations.

    • Solution: Engineering stable variants through site-directed mutagenesis or truncation studies, guided by sequence conservation analysis.

  • Transient interactions:

    • Challenge: The dynamic nature of Ycf4's interactions with PSI components makes structural studies difficult.

    • Solution: Cross-linking approaches to stabilize protein-protein interactions before structural analysis.

  • Complex size:

    • Challenge: The large size of the Ycf4-containing complex (>1500 kD) complicates structural studies.

    • Solution: Cryo-electron microscopy (cryo-EM) is particularly suited for such large complexes and can provide structural information without the need for crystallization.

  • Advanced approaches:

    • Single-particle cryo-EM combined with molecular dynamics simulations

    • Hydrogen-deuterium exchange mass spectrometry to map protein interaction surfaces

    • Integrative structural biology combining multiple experimental approaches (X-ray crystallography, NMR, SAXS, cryo-EM)

What control experiments should be included when studying the effects of ycf4 mutations in Prochlorococcus?

When studying ycf4 mutations in Prochlorococcus, several crucial controls should be implemented:

  • Wild-type controls:

    • Include the parent strain for all measurements

    • Compare phenotypes under identical growth conditions

    • Use the same genetic background for all experiments

  • Complementation studies:

    • Re-introduce the wild-type ycf4 gene to confirm phenotype rescue

    • Use site-specific integration to ensure proper expression

    • Include partial complementation (e.g., N-terminal or C-terminal domains only)

  • TAP-tagging controls:

    • Create TAP-tagged Ycf4 control strains to ensure tag doesn't interfere with function

    • Confirm photosynthetic activity through fluorescence induction kinetics

    • Verify growth rates match wild-type under varying light conditions (50-1000 μE·m⁻²·s⁻¹)

  • Marker gene controls:

    • Include strains with marker genes but intact ycf4 to control for marker effects

    • Verify homoplasmy/heteroplasmy status through PCR and Southern blot analysis

    • Monitor spontaneous mutations in marker genes

  • Growth condition variables:

    • Test multiple light intensities (high, medium, low)

    • Assess growth with and without external carbon sources

    • Evaluate responses to different nutrient limitations

How can researchers distinguish between direct and indirect effects of ycf4 mutation on photosystem I assembly?

Distinguishing direct from indirect effects of ycf4 mutation requires sophisticated experimental approaches:

  • Temporal analysis:

    • Analyze PSI assembly immediately after ycf4 inactivation (using inducible systems)

    • Use pulse-chase labeling to track newly synthesized PSI components

    • Monitor the assembly process over time to identify the earliest defects

  • Biochemical fractionation:

    • Isolate thylakoid membrane complexes at different assembly stages

    • Use sucrose gradient ultracentrifugation and ion exchange chromatography

    • Compare subunit composition of PSI subcomplexes in wild-type vs. mutants

  • Protein interaction mapping:

    • Use co-immunoprecipitation with antibodies against Ycf4 and PSI components

    • Perform cross-linking studies to capture transient interactions

    • Employ label-free quantitative proteomics to identify direct binding partners

  • Domain-specific mutations:

    • Create point mutations in specific domains of Ycf4 (e.g., R120A, R120Q)

    • Analyze the impact on protein stability using chloramphenicol incubation

    • Compare with complete knockout to differentiate assembly vs. stability functions

  • Transcriptome/proteome analysis:

    • Compare global changes in gene/protein expression

    • Identify primary vs. secondary effects through time-course experiments

    • Use principal component analysis to separate direct from compensatory responses

What are common misinterpretations when analyzing ycf4 knockout phenotypes in photosynthetic organisms?

Several common misinterpretations can occur when analyzing ycf4 knockout phenotypes:

How can researchers address contradictory findings regarding the essentiality of ycf4 in different photosynthetic organisms?

Addressing contradictory findings about ycf4 essentiality requires careful methodological consideration:

  • Standardize knockout strategies:

    • Ensure complete deletion of coding sequences rather than partial disruptions

    • Verify homoplasmy through multiple methods (PCR, Southern blot)

    • Document the precise deletion boundaries at nucleotide resolution

  • Comparative experimentation:

    • Test multiple species under identical conditions

    • Create knockouts in the same genetic backgrounds

    • Use standardized photosynthetic measurements

  • Functional domain mapping:

    • Compare N-terminal vs. C-terminal deletions

    • Perform complementation with chimeric proteins

    • Conduct site-directed mutagenesis of conserved residues

  • Reconcile evolutionary context:

    • Consider the photosynthetic apparatus composition in each organism

    • Evaluate the presence of compensatory pathways

    • Analyze evolutionary rate variation as seen in legumes vs. cyanobacteria

  • Growth condition matrix:

    • Test multiple combinations of:

      • Light intensities

      • Carbon sources

      • Nutrient availability

      • Temperature regimes

This matrix approach can reveal condition-specific essentiality, explaining apparent contradictions in the literature between studies in tobacco, Chlamydomonas, and cyanobacteria .

What are the most promising avenues for future research on Ycf4 in Prochlorococcus marinus?

Future research on Ycf4 in Prochlorococcus should focus on:

  • Structural biology:

    • Determine high-resolution structures of Ycf4 alone and in complex with PSI components

    • Map the interaction interfaces using hydrogen-deuterium exchange mass spectrometry

    • Use cryo-EM to visualize assembly intermediates

  • Ecological adaptations:

    • Compare Ycf4 function in high-light vs. low-light adapted Prochlorococcus ecotypes

    • Investigate how Ycf4 contributes to the efficiency of the minimal photosynthetic apparatus

    • Study ycf4 expression under oceanic conditions (varying light, nutrient limitation)

  • Regulatory networks:

    • Explore the unexpected role of Ycf4 in regulating transcription of other photosynthetic genes

    • Identify potential DNA binding or RNA binding capabilities

    • Map the protein interaction network beyond PSI components

  • Engineering applications:

    • Design optimized Ycf4 variants for more efficient photosynthesis

    • Explore the potential for Ycf4 to enhance photosynthetic efficiency in other organisms

    • Apply knowledge to artificial photosynthetic systems

  • Evolutionary diversification:

    • Compare the extreme sequence diversity seen in plant Ycf4 (e.g., legume hypermutation) with the relative conservation in Prochlorococcus

    • Investigate the selective pressures that maintain ycf4 in the minimal genome of Prochlorococcus

What methodological advances would accelerate research on Ycf4 function in photosynthetic organisms?

Several methodological advances would significantly accelerate Ycf4 research:

  • Improved genetic tools for Prochlorococcus:

    • Development of more efficient transformation systems

    • CRISPR-Cas9 editing of the plastid genome

    • Inducible gene expression/repression systems

  • Advanced structural techniques:

    • Time-resolved cryo-EM to capture dynamic assembly processes

    • Integration of AlphaFold predictions with experimental structural data

    • Single-molecule tracking of Ycf4 during PSI assembly

  • In vivo visualization:

    • Super-resolution microscopy techniques to track Ycf4 localization

    • Bioorthogonal labeling systems for protein tracking in intact cells

    • Split fluorescent proteins to visualize protein-protein interactions

  • Systems biology approaches:

    • Multi-omics integration (genomics, transcriptomics, proteomics, metabolomics)

    • Machine learning algorithms to identify patterns in complex datasets

    • Quantitative models of photosystem assembly dynamics

  • Translational applications:

    • High-throughput screening for improved photosynthesis

    • Synthetic biology approaches to create optimized photosynthetic modules

    • Directed evolution of Ycf4 for enhanced functionality

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.