Recombinant Prochlorococcus marinus Photosystem I reaction center subunit III (psaF)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. To request a specific tag, please inform us, and we will prioritize its development.
Synonyms
psaF; Pro_0467; Photosystem I reaction center subunit III; PSI-F
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
24-183
Protein Length
Full Length of Mature Protein
Species
Prochlorococcus marinus (strain SARG / CCMP1375 / SS120)
Target Names
psaF
Target Protein Sequence
AGEAVNADRAATDFTASALTTCSENTRFNERASQATTPKDIARFERYSKASCGDDGLPHL VIAATIEPWGALANRHHEGDILIPGHIFIYVAGIIGWSGREYLRASKKTKNPAENEIIID FALARQCLIKGAAWPVEANKQGRSGDLREKDENISLNGPR
Uniprot No.

Target Background

Function

This protein likely plays a role in the efficient electron transfer from plastocyanin to P700 (or cytochrome c553 in algae and cyanobacteria). Its function as a plastocyanin-docking protein contributes to the specific binding of plastocyanin to Photosystem I (PSI).

Database Links
Protein Families
PsaF family
Subcellular Location
Cellular thylakoid membrane; Single-pass membrane protein.

Q&A

What are the optimal expression conditions for recombinant Prochlorococcus marinus psaF protein in E. coli?

For optimal expression of recombinant Prochlorococcus marinus psaF in E. coli, researchers typically use the following approach:

  • Vector selection: A pET-based expression system with an N-terminal His-tag is recommended for easy purification.

  • Expression strain: BL21(DE3) or similar E. coli strains that lack the lon and ompT proteases are preferred to minimize protein degradation.

  • Induction conditions: Expression at lower temperatures (16-18°C) after induction with 0.1-0.5 mM IPTG can improve protein folding and solubility.

  • Medium composition: Enriched media such as 2xYT or TB (Terrific Broth) typically yield better results than standard LB medium.

  • Harvest timing: Optimal expression is usually achieved 16-20 hours post-induction when grown at reduced temperatures.

When designing expression experiments, consider that the unique insertions in psaF may affect protein folding in heterologous systems .

What purification strategies are most effective for obtaining high-purity recombinant psaF protein?

For high-purity recombinant psaF protein from Prochlorococcus marinus, a multi-step purification strategy is recommended:

  • Initial capture: Immobilized metal affinity chromatography (IMAC) using Ni-NTA resin is effective for His-tagged psaF protein. A gradient elution with imidazole (20-250 mM) typically yields better separation than step elution.

  • Intermediate purification: Ion exchange chromatography can remove remaining contaminants. Given the theoretical pI of psaF, anion exchange (Q-Sepharose) at pH 8.0 is often effective.

  • Polishing step: Size exclusion chromatography (Superdex 75 or 200) in a buffer containing 20 mM Tris-HCl pH 8.0, 150 mM NaCl yields highly pure protein.

  • Buffer optimization: The final product is typically most stable when stored in Tris/PBS-based buffer with 6% trehalose at pH 8.0, as used in commercial preparations .

This process typically yields protein with >90% purity as determined by SDS-PAGE, suitable for structural and functional studies .

How can researchers effectively study the interaction between psaF and other photosystem components?

To study interactions between psaF and other photosystem components, researchers can employ several complementary approaches:

  • Co-immunoprecipitation (Co-IP): Using antibodies against psaF or its binding partners (particularly PsaJ) to pull down protein complexes from Prochlorococcus lysates. This can be followed by mass spectrometry to identify interacting proteins.

  • Yeast two-hybrid (Y2H) screening: While challenging for membrane proteins, modified Y2H systems can identify direct protein-protein interactions involving psaF.

  • Surface plasmon resonance (SPR): This technique can measure binding kinetics between purified psaF and potential binding partners like plastocyanin or cytochrome c₆.

  • Crosslinking mass spectrometry: Chemical crosslinking followed by digestion and mass spectrometry can identify protein residues in close proximity, providing insight into interaction interfaces.

  • In silico docking studies: Computational approaches can predict interaction surfaces between psaF and other proteins based on the known anomalous structure of Prochlorococcus psaF.

These methods can help elucidate how the unique structural features of Prochlorococcus psaF affect its interactions with other components of the photosynthetic apparatus .

What structural techniques are most informative for characterizing the unique insertion in Prochlorococcus marinus psaF?

To characterize the unique insertion in Prochlorococcus marinus psaF, several structural biology techniques are particularly informative:

Comparing structures of psaF from Prochlorococcus with those from other cyanobacteria can illuminate how the insertion affects protein function in different environmental contexts .

How has the unusual structure of psaF evolved in Prochlorococcus marinus in relation to its marine environment?

The unusual structure of psaF in Prochlorococcus marinus likely evolved as part of the organism's adaptation to its oceanic niche:

  • Genome streamlining: Prochlorococcus has undergone significant genome reduction, with its genome size of approximately 1.7 Mbp being among the smallest of any photosynthetic organism . This reduction is thought to be advantageous in nutrient-deprived environments .

  • Evolutionary timing: The major genome reduction event in Prochlorococcus, which likely included modifications to photosystem components, has been linked to the Neoproterozoic Snowball Earth climate catastrophe. This event likely created strong selective pressures for cellular and metabolic efficiency .

  • Niche specialization: The unusual psaF structure may contribute to the specialized light-harvesting capabilities of Prochlorococcus, which allow it to thrive in low-light conditions at the bottom of the illuminated ocean layer .

  • Ecotype differentiation: Different Prochlorococcus ecotypes show adaptations to varying light and nutrient conditions. The modifications in psaF may play a role in the photosynthetic efficiency of different ecotypes across the water column .

Phylogenetic analyses suggest that these structural modifications in psaF occurred early in Prochlorococcus evolution, potentially facilitating its divergence from other marine cyanobacteria like Synechococcus .

How do the photosystem adaptations in Prochlorococcus, including modifications to psaF, compare with those in Synechococcus?

The photosystem adaptations in Prochlorococcus, including modifications to psaF, show significant differences compared to Synechococcus, reflecting their distinct ecological strategies:

FeatureProchlorococcusSynechococcusEcological Significance
psaF structureContains unique insertion in central regionConventional structureMay affect electron transfer efficiency in different light regimes
Photosystem I organizationPSI contains Chl b₂, unusual for cyanobacteriaNo Chl b, conventional PSI structureEnables Prochlorococcus to harvest blue light more efficiently at depth
Stress responseLess robust response to light and UV stressMore efficient protection mechanismsSynechococcus can tolerate wider range of light conditions
Genome sizeHighly reduced (1.7-2.5 Mbp)Larger (2.4-3.0 Mbp)Prochlorococcus optimized for resource-limited environments
Pigment compositionDivinyl chlorophylls a₂ and b₂PhycobilisomesDifferent light-harvesting strategies

Research has shown that Prochlorococcus is more sensitive than Synechococcus to oxidative stress, as indicated by different degrees of PSII photoinactivation after exposure to hydrogen peroxide. The modifications in psaF and other photosystem components may represent adaptations to minimize cellular resources while maintaining photosynthetic function in Prochlorococcus' specialized niche .

While Synechococcus has developed robust mechanisms to cope with light and UV stress, Prochlorococcus appears to survive stressful periods by deploying a minimal set of protection mechanisms and temporarily reducing key metabolic processes .

What challenges exist in developing genetic systems for manipulating psaF in Prochlorococcus marinus?

Developing genetic systems for manipulating psaF in Prochlorococcus marinus presents several significant challenges:

  • Low transformation efficiency: Prochlorococcus has proven exceptionally difficult to transform. Efforts using conjugation methods that work in other cyanobacteria have been largely unsuccessful, even when using agar stab mating procedures designed to improve cell survivability .

  • Host defense mechanisms: Restriction-modification systems in Prochlorococcus may degrade incoming DNA, complicating transformation efforts .

  • Lack of self-replicating plasmids: No naturally occurring plasmids have been found in Prochlorococcus, and broad host range plasmids that function in related marine Synechococcus strains have failed to replicate in Prochlorococcus .

  • Cell fragility: Prochlorococcus cells are extremely sensitive to handling, with poor survival during standard transformation procedures. While electroporation conditions have been optimized (7 kV/cm electric field, 15 ms time constant), survival rates remain problematic .

  • Growth conditions: The slow growth rate of Prochlorococcus (typically requiring 2-3 months for colonies to become visible) complicates genetic work .

These challenges have limited our ability to conduct site-directed mutagenesis studies on psaF to understand the functional significance of its unique structural features. Alternative approaches using heterologous expression in model organisms remain the most feasible strategy .

What heterologous expression systems have been successfully used to study Prochlorococcus marinus proteins, including psaF?

Several heterologous expression systems have been successfully used to study Prochlorococcus marinus proteins, including photosystem components like psaF:

  • E. coli expression systems: The most widely used approach, as demonstrated by the successful expression of His-tagged psaF protein . The pET expression system has proven particularly effective, though optimization of codon usage may be necessary due to the low GC content of Prochlorococcus genes (approximately 36.4%) .

  • Marine Synechococcus: As a close relative of Prochlorococcus, Synechococcus provides a more native-like environment for expression of photosystem proteins. The Pro1404 gene from P. marinus SS120 has been successfully expressed in Synechococcus sp. PCC 7942 .

  • Synechocystis sp. PCC 6803: This model cyanobacterium has been used to express and study Prochlorococcus proteins, though its higher GC content (43%) compared to Prochlorococcus (36.4%) can necessitate codon optimization .

  • Cell-free expression systems: These have been employed for expressing difficult membrane proteins from Prochlorococcus, allowing rapid screening of conditions for optimal folding and solubility.

For successful expression of psaF, researchers should consider:

  • Codon optimization based on the host organism

  • Addition of solubility tags (SUMO, MBP, or TrxA) for improved protein folding

  • Expression at reduced temperatures (16-20°C) to enhance proper folding

  • Use of specialized E. coli strains designed for membrane protein expression (C41(DE3), C43(DE3))

The recombinant protein can then be used for structural studies, interaction analyses, and functional characterization .

How can researchers effectively use recombinant psaF to study electron transport in Prochlorococcus photosystems?

To study electron transport in Prochlorococcus photosystems using recombinant psaF, researchers can employ several sophisticated approaches:

  • Reconstitution experiments: Purified recombinant psaF can be incorporated into liposomes with other photosystem components to create a minimal functional system. This allows measurement of electron transfer rates under controlled conditions.

  • Electrochemical analysis: Techniques such as protein film voltammetry can directly measure electron transfer between recombinant psaF and electron donors/acceptors when the protein is immobilized on an electrode surface.

  • Rapid kinetic measurements: Laser flash photolysis coupled with absorption spectroscopy can resolve the ultrafast electron transfer events involving psaF in reconstituted systems.

  • Site-directed mutagenesis: Strategic mutations can be introduced to the recombinant psaF, particularly in the unique insertion region, to assess how specific residues contribute to electron transfer efficiency.

  • Comparative studies: Parallel analysis of psaF from both high-light and low-light adapted Prochlorococcus ecotypes can reveal adaptations in electron transport systems to different light environments .

These techniques can help elucidate how the structural adaptations in Prochlorococcus psaF affect electron transfer efficiency under the low-light conditions where many Prochlorococcus strains thrive .

What methods are available for studying how psaF contributes to Prochlorococcus adaptation to different light environments?

To investigate how psaF contributes to Prochlorococcus adaptation to different light environments, researchers can utilize several complementary approaches:

  • Comparative transcriptomics: Analyzing expression patterns of psaF in Prochlorococcus cultures acclimated to different light intensities. RNA-Seq data from MIT9301 has shown that photosynthetic gene expression varies significantly with temperature acclimation, suggesting similar responses may occur with light acclimation .

  • Metatranscriptomics analysis: Examining psaF expression in natural Prochlorococcus populations across ocean depth profiles with varying light conditions. The Tara Oceans metatranscriptome dataset has been successfully used to track expression of photosystem genes in relation to environmental gradients .

  • Photoinhibition studies: Measuring PSII quantum yield recovery in the presence of protein synthesis inhibitors (like lincomycin) can quantify repair rates in different strains or under different light conditions, revealing the contribution of psaF to photosystem resilience .

  • Oxidative stress response: Comparing the response to hydrogen peroxide exposure between wild-type cells and those with modified psaF can reveal its role in coping with light-induced oxidative damage .

  • Fluorescence lifetime measurements: These can provide insight into energy transfer efficiency within the photosystems under different light conditions, highlighting the functional significance of psaF structural adaptations.

These approaches can be integrated to develop a comprehensive understanding of how the unique features of Prochlorococcus psaF contribute to its remarkable success across diverse oceanic light environments .

How might the unusual structure of psaF affect state transitions and energy distribution between photosystems in Prochlorococcus?

The unusual structure of psaF may significantly impact state transitions and energy distribution between photosystems in Prochlorococcus through several mechanisms:

  • Altered interaction with mobile light-harvesting components: The insertion in the central part of Prochlorococcus psaF likely changes its surface properties, potentially affecting how it interacts with mobile light-harvesting components during state transitions.

  • Impact on PSI trimerization: Research on Synechococcus strain PCC 7002 has shown that mutations in psaL (another PSI protein with anomalous size in Prochlorococcus) affect state transitions, with transitions from state 2 to state 1 proceeding approximately three times more rapidly in psaL mutants than in wild type. This suggests the anomalous PsaL in Prochlorococcus might similarly influence state transition kinetics .

  • Altered plastocyanin/cytochrome c₆ docking: Since PsaF is involved in docking negatively charged electron donors such as plastocyanin, the structural modifications in Prochlorococcus psaF may affect the efficiency of electron transfer from plastocyanin to P700 (the PSI reaction center), influencing energy distribution between photosystems .

  • PSI-PSII ratio regulation: The unusual structure may contribute to maintaining appropriate PSI-PSII ratios under changing light conditions, a critical adaptation for organisms living across a range of ocean depths.

  • Redox sensing: The modified psaF might play a role in sensing redox conditions, contributing to the regulation of state transitions in response to the oxidation state of the plastoquinone pool.

These mechanisms would be particularly important for Prochlorococcus in managing the transition between day and night conditions or when cells are displaced vertically in the water column .

What are the most promising research directions for understanding the relationship between psaF structure and Prochlorococcus ecological success?

The most promising research directions for understanding the relationship between psaF structure and Prochlorococcus ecological success include:

  • Comparative genomics across environmental gradients: Expanding analysis of psaF sequences from different Prochlorococcus ecotypes across ocean depth, latitude, and nutrient gradients. Recent studies have shown high rates of homologous recombination (r/m values well in excess of 1) for photosystem genes, suggesting strong selection pressures .

  • Structure-function analysis of the insertion region: Using advanced protein engineering techniques to systematically modify the insertion in psaF and assess impacts on photosystem efficiency under different light and temperature regimes.

  • Integration with membrane lipid research: Investigating how the unique structure of psaF interacts with the specialized membrane lipids of Prochlorococcus, which may contribute to photosystem stability under varying environmental conditions.

  • Synthetic ecology approaches: Creating experimental systems where Prochlorococcus variants with modified psaF compete under controlled environmental conditions, potentially using transposome electroporation techniques that have shown promise for genetic manipulation .

  • Advanced imaging of natural communities: Applying single-cell resolution techniques to visualize photosystem arrangement and energy transfer in wild Prochlorococcus populations across environmental gradients.

  • Transcriptional regulation analysis: Investigating how light and temperature influence psaF expression, potentially building on the observation that Prochlorococcus switches to minimal protection mechanisms during stressful periods .

These research directions could provide crucial insights into how the structural adaptations in psaF contribute to the remarkable ecological success of Prochlorococcus as the most abundant photosynthetic organism on Earth .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.