Recombinant Prochlorococcus marinus Photosystem I reaction center subunit XI (psaL)

Shipped with Ice Packs
In Stock

Description

Protein Composition and Sequence

The recombinant psaL protein is derived from Prochlorococcus marinus, a marine cyanobacterium with streamlined genomes optimized for oligotrophic environments . Key structural features include:

  • Full-Length Sequence: 199 amino acids (1–199 aa) with an N-terminal His tag for purification .

Production and Purity

  • Host Systems: Expressed in E. coli , yeast, baculovirus, or mammalian cells .

  • Purity: >90% (SDS-PAGE) or ≥85% .

  • Form: Lyophilized powder or solution in Tris/PBS buffer with 50% glycerol .

Table 1: Recombinant psaL Variants and Host Systems

Source OrganismHost SystemPurityTagLength
P. marinus MIT 9215E. coli>90%HisFull (1–199 aa)
P. marinus CCMP1375E. coli>85%UnspecifiedFull (1–199 aa)
P. marinus MIT 9301Baculovirus>85%UnspecifiedPartial

Functional Role in Photosynthesis

psaL is a subunit of PSI, a light-driven electron transport complex. Key functional insights include:

  • PSI Trimer Formation: Facilitates the assembly of PSI trimers, critical for structural stability and functional efficiency .

  • State Transitions: Affects the mobility of PSI particles, influencing transitions between states 1 and 2 (linked to photosynthetic regulation) .

  • Electron Transfer: Interacts with plastocyanin or cytochrome c6, mediating electron transfer from PSII to PSI .

Table 2: Functional Domains and Interactions

DomainFunctionInteracting Partners
N-Terminal ExtensionStabilizes PSI trimersPsaI subunit
Central RegionBinds chlorophyll and carotenoidsPSI core proteins
C-Terminal RegionFacilitates electron transferPlastocyanin/cytochrome c6

Ecological and Evolutionary Studies

  • Prochlorococcus Diversity: Genomic analyses reveal psaL variations across ecotypes (e.g., HL II vs. HNLC clades), linked to niche specialization in iron-limited or high-light environments .

  • Pan-Genome Analysis: Over 80,000 genes identified in Prochlorococcus genomes, with psaL conserved across strains .

Biotechnological Potential

  • Bioengineering: Serves as a scaffold for designing artificial photosynthetic systems.

  • Protein Stability Studies: Insights into trehalose/glycerol-based stabilization protocols for lyophilized proteins .

Challenges and Considerations

  • Stability: Repeated freeze-thaw cycles degrade activity; storage at -20°C/-80°C is essential .

  • Host Expression Limitations: E. coli may misfold eukaryotic or cyanobacterial proteins; baculovirus systems improve folding accuracy .

  • Partial vs. Full-Length: Partial constructs (e.g., 1–167 aa) may lack functional domains, affecting experimental outcomes .

Related Research and Future Directions

  • Genomic Taxonomy: Prochlorococcus genomes reveal horizontal gene transfer (e.g., iron-scavenging genes) and prophage integration .

  • Climate Change Impacts: Monitoring Prochlorococcus populations with psaL as a marker could track ocean health and biogeochemical cycles .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
The specific tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
psaL; A9601_17231; Photosystem I reaction center subunit XI; PSI subunit V; PSI-L
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-199
Protein Length
full length protein
Species
Prochlorococcus marinus (strain AS9601)
Target Names
psaL
Target Protein Sequence
MSDFQKSFSESTSSIKFDEKYIDNSVQPNDIGVAEQWAVKTVADPCVGNLATPVNSGYFT KAFINNLPFYREGISPNFRGLETGAAFGYLLYGPFTMTGPLRNSEFALTAGLLAAIGAVH ILTALLVLYNAPGKAPNVQPPDATVNNPPKDLFTRAGWADFTSGFWLGGCGGSVFAWLLV GTLHLDTIMPIIKNIWTAG
Uniprot No.

Target Background

Database Links
Protein Families
PsaL family
Subcellular Location
Cellular thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the function of PsaL in Prochlorococcus marinus?

PsaL in Prochlorococcus marinus functions as a critical structural component of Photosystem I (PSI), primarily involved in the formation and stabilization of PSI trimers. Despite having an anomalous length compared to PsaL homologs in other cyanobacteria, it maintains similar functions in PSI complex organization . The PsaL protein works in conjunction with PsaI to form complexes that are implicated in the formation or stabilization of PSI trimers, which are important for optimal photosynthetic efficiency in the variable light conditions that marine cyanobacteria experience .

Functional studies in related cyanobacteria have revealed that PsaL also plays a significant role in state transitions, which are adaptations that balance the distribution of excitation energy between Photosystem I and Photosystem II. Knockout mutants of Synechococcus strain PCC 7002 with psaL mutations showed that transitions from state 2 to state 1 proceeded approximately three times more rapidly than in the wild type . This faster transition was linked to the missing ability to form PSI trimers in the mutant and the consequently enhanced mobility of PSI particles in the thylakoid membrane .

What structural features characterize the PsaL protein in Prochlorococcus marinus?

PsaL in Prochlorococcus marinus exhibits several important structural features that are essential for its function in PSI complex assembly and stability:

  • The protein consists of 199 amino acids with specific regions dedicated to membrane insertion and interaction with other PSI subunits .

  • PsaL contains hydrophobic regions that anchor it within the thylakoid membrane, with its structural arrangement allowing for interaction with the PsaI subunit to form a functional complex .

  • The protein includes binding sites for chlorophyll molecules, which are integral to its function in energy transfer within the photosystem .

  • Crystal structures of PSI complexes show that PsaL occupies a position at the periphery of the PSI monomer, where it can facilitate interactions with adjacent monomers to form the characteristic trimeric structure of cyanobacterial PSI .

  • In higher plants, the extended eukaryotic-specific loop of PsaL interacts with PsaH, creating connections to additional chlorophyll networks that are proposed to link PSI to light-harvesting complex II (LHCII) during state transitions .

Despite having an anomalous length compared to PsaL in other cyanobacteria, the Prochlorococcus PsaL maintains the essential structural elements required for PSI trimer formation .

How does PsaL from Prochlorococcus compare to homologs in other cyanobacteria?

PsaL from Prochlorococcus marinus shows both similarities and distinctive differences when compared to homologs in other cyanobacteria:

FeatureProchlorococcus PsaLTypical Cyanobacterial PsaL
LengthAnomalous (longer)Standard length
FunctionPSI trimer formationPSI trimer formation
Genomic contextCo-transcribed with psaICo-transcribed with psaI
Role in state transitionsInfluences transition ratesInfluences transition rates
Evolutionary adaptationSpecialized for oceanic environmentVaries by habitat

Despite differences in primary sequence, the core functional domains of PsaL appear to be conserved across cyanobacteria, allowing for comparable roles in photosystem assembly . The unique adaptations in Prochlorococcus PsaL likely reflect evolutionary adaptations to the specific light and nutrient conditions of its oceanic habitat .

Functional comparisons with PsaL from Synechococcus suggest conserved roles in state transitions and energy distribution between photosystems, with knockout studies revealing that PsaL influences the rate of state transitions, possibly through its role in PSI trimerization .

What role does PsaL play in photosystem I assembly?

PsaL plays a crucial role in the assembly and structural organization of photosystem I (PSI) in Prochlorococcus marinus and other cyanobacteria:

  • The primary function of PsaL is in the formation and stabilization of PSI trimers, a characteristic structural arrangement in cyanobacteria that optimizes light harvesting efficiency .

  • PsaL works in conjunction with PsaI to form complexes that mediate interactions between adjacent PSI monomers, facilitating the assembly of the trimeric structure .

  • The positioning of PsaL at the periphery of the PSI monomer allows it to participate in inter-monomer contacts that are essential for trimer formation .

  • Beyond its structural role, PsaL also contributes to the proper association of chlorophyll molecules within the PSI complex, influencing energy transfer pathways within the photosystem .

  • In higher plants, PsaL forms connections to additional chlorophyll networks that are proposed to link PSI to light-harvesting complex II (LHCII) during state transitions, suggesting a role in dynamic reorganization of the photosynthetic apparatus .

These functions highlight the importance of PsaL not just as a structural component but as a key player in the dynamic organization and function of the photosynthetic apparatus.

How does the regulation of psaL gene expression differ between high-light and low-light adapted ecotypes of Prochlorococcus?

The regulation of psaL gene expression in Prochlorococcus marinus exhibits significant differences between high-light (HL) and low-light (LL) adapted ecotypes, reflecting their distinct ecological adaptations:

CharacteristicHigh-Light EcotypesLow-Light Ecotypes
Taxonomic classificationGenus EurycoliumGenera Prochlorococcus, Prolificoccus, Riococcus, Thaumococcus
GC content30-33%34-38% (most LL); 50-50.7% (LLIV)
Response to light changesStrong, rapid responseMore stable expression
Small RNA regulationSignificant PsrR1 regulationLess pronounced PsrR1 regulation
Ecological nicheSurface waters, variable lightDeeper waters, stable low light

High-light ecotypes (such as MED4/CCMP1986) show distinctive regulatory patterns compared to low-light ecotypes, with more pronounced upregulation under moderate light and downregulation under high light stress .

A critical regulatory mechanism involves the small regulatory RNA PsrR1, which is induced shortly after a shift from moderate to high-light conditions . PsrR1 interacts with the ribosome binding regions of the psaL mRNA, leading to post-transcriptional regulation . In the presence of PsrR1, the psaL mRNA is processed by RNase E, providing a mechanism for rapid adjustment of PsaL levels in response to changing light conditions .

This regulation appears to be more significant in HL ecotypes, contributing to their ability to rapidly adjust photosystem composition under fluctuating light conditions typical of surface waters . Additionally, psaL expression is coordinated with other photosynthesis-related genes like psaJ, chlN, and cpcA, suggesting integrated regulation of the photosynthetic apparatus .

What methodologies are effective for expressing and purifying recombinant PsaL proteins from Prochlorococcus?

Expressing and purifying recombinant PsaL proteins from Prochlorococcus marinus requires specialized methodologies to overcome challenges associated with membrane proteins and the specific characteristics of this cyanobacterial protein:

Expression Systems and Strategies:

  • E. coli-based expression: Modified E. coli strains (such as BL21(DE3) or C41(DE3)) with expression vectors containing codon-optimized psaL sequences to accommodate the low GC content (36-37%) of Prochlorococcus genes .

  • Cyanobacterial host systems: Expression in model cyanobacteria like Synechocystis sp. PCC 6803 can provide a more native-like environment for proper folding and assembly of PsaL .

  • Fusion tags: Attaching solubility-enhancing tags can improve expression and folding of recombinant PsaL .

  • Induction conditions: Lower temperatures (16-20°C) and reduced inducer concentrations often improve the yield of properly folded membrane proteins.

Purification Protocol:

StepMethodologyPurpose
1. Membrane isolationDifferential centrifugation with sucrose gradient separationIsolate thylakoid membranes
2. Detergent solubilizationn-dodecyl-β-D-maltoside or digitoninSolubilize membrane proteins without denaturation
3. Affinity chromatographyUsing attached tag (His, GST, etc.)Initial purification
4. Size exclusion chromatographySuperdex or Sephacryl columnsFinal purification and oligomeric state assessment
5. Buffer optimizationTris-based buffer with 50% glycerolEnhance protein stability

Storage Conditions:

The purified recombinant protein should be stored in a Tris-based buffer with 50% glycerol at -20°C, with extended storage at -80°C . Repeated freezing and thawing should be avoided, and working aliquots can be stored at 4°C for up to one week .

These methodologies provide a framework that can be adapted based on specific research goals and the intended applications of the recombinant PsaL protein.

How does the small RNA PsrR1 influence psaL expression at the post-transcriptional level?

The small regulatory RNA PsrR1 (also known as SyR1) exerts sophisticated post-transcriptional control over psaL expression in Prochlorococcus marinus and other cyanobacteria:

Mechanism of PsrR1-mediated regulation:

  • Target recognition: PsrR1 binds to complementary sequences in the ribosome binding region of the psaL mRNA, with the interaction domains clustered in the central conserved region of the sRNA .

  • Translation inhibition: By binding to the ribosome binding site (RBS) or overlapping with the translational start codon of psaL mRNA, PsrR1 inhibits translation initiation, reducing protein synthesis without necessarily affecting mRNA levels .

  • mRNA processing: In the presence of PsrR1, the psaL mRNA is processed by RNase E, providing a mechanism for rapid degradation of the target mRNA .

  • Light-responsive regulation: PsrR1 expression is induced shortly after a shift from moderate to high-light conditions, linking this regulatory mechanism to environmental cues that are relevant for photosynthetic organisms .

  • Coordinated regulation: Besides psaL, PsrR1 also targets other photosynthesis-related mRNAs like psaJ, chlN, and cpcA, suggesting a role in coordinating the expression of multiple components of the photosynthetic apparatus .

Experimental evidence for PsrR1-psaL interaction:

Computational target prediction identified psaL as one of the top three targets of PsrR1, along with the phycocyanin α-subunit CpcA and the phycobilisome core component ApcF . This interaction was confirmed by mutational analysis in a heterologous reporter system, and evidence for posttranscriptional regulation of psaL by PsrR1 was observed in wild-type cells under various environmental conditions .

This regulatory mechanism allows Prochlorococcus to rapidly adjust its photosynthetic apparatus in response to changing light conditions, which is particularly important for organisms living in dynamic marine environments.

What implications does the anomalous length of Prochlorococcus PsaL have for photosystem I function?

The anomalous length of PsaL in Prochlorococcus marinus has several important implications for photosystem I function and the ecological adaptations of this marine cyanobacterium:

Structural implications:

  • Despite its unusual length, Prochlorococcus PsaL maintains the ability to form complexes with PsaI and participate in PSI trimer formation, suggesting conservation of core functional domains .

  • The altered protein dimensions might influence the spacing and orientation of PSI trimers in the thylakoid membrane, potentially affecting excitation energy transfer between adjacent photosystems.

  • Crystal structure studies of virus-like photosystem I complexes suggest that modifications in PSI proteins can affect interactions with electron donors, as seen with phage-specific mutations in PsaF that result in promiscuous PSI complexes .

Functional implications:

  • State transitions: Studies in Synechococcus suggest that PsaL influences the rate of transitions between different photosynthetic states . The unique structure of Prochlorococcus PsaL might modulate these transitions in ways that are adapted to its specific marine environment.

  • Electron donor interactions: The structural peculiarities of Prochlorococcus PsaL might influence interactions with electron donors like plastocyanin or cytochrome c553, potentially affecting electron transfer efficiency .

  • Energy transfer pathways: The specific arrangement of chlorophyll molecules associated with PsaL contributes to energy transfer pathways within PSI . Variations in PsaL structure could modulate these pathways, affecting photosynthetic efficiency under different light conditions.

Evolutionary implications:

The unique features of Prochlorococcus PsaL likely represent adaptations to the specific light and nutrient conditions of its oceanic habitat . These adaptations might contribute to the remarkable ecological success of Prochlorococcus as the most abundant photosynthetic organism in the ocean . The conservation of these unusual features across Prochlorococcus ecotypes suggests they confer significant adaptive advantages despite deviating from the more typical cyanobacterial PsaL structure.

How do mutations in the psaL gene affect state transitions and energy distribution in photosynthetic membranes?

Mutations in the psaL gene have profound effects on state transitions and energy distribution in photosynthetic membranes, as revealed by studies in cyanobacteria:

Effects on state transitions:

  • Accelerated transitions: Knockout mutants of Synechococcus strain PCC 7002 with psaL mutations showed that transitions from state 2 to state 1 proceeded approximately three times more rapidly than in the wild type .

  • Mechanistic basis: The accelerated transitions in psaL mutants are linked to the missing ability to form PSI trimers and the consequently enhanced mobility of PSI particles in the thylakoid membrane .

  • Regulatory implications: These findings suggest that PsaL-mediated trimerization not only affects PSI structure but also constrains the dynamics of photosynthetic complexes in ways that influence their regulatory responses.

Effects on energy distribution:

  • Excitation energy transfer: PSI trimerization, mediated by PsaL, affects the efficiency and pathways of excitation energy transfer within and between photosynthetic complexes.

  • Light harvesting coordination: In plants, the extended eukaryotic-specific loop of PsaL interacts with PsaH, creating connections to additional chlorophyll networks that are proposed to link PSI to light-harvesting complex II (LHCII) during state transitions .

  • Adaptation to light conditions: The regulatory role of PsaL in energy distribution might be particularly important under fluctuating light conditions, where efficient adjustment of energy allocation between photosystems is critical for maintaining photosynthetic efficiency.

Implications for Prochlorococcus research:

In the dynamic light environment of the ocean, efficient regulation of state transitions could be particularly important for Prochlorococcus, potentially explaining the conservation of PsaL function despite its anomalous structure . Differences in psaL regulation and function between high-light and low-light adapted ecotypes might contribute to their distinct ecological strategies . Comparative studies of psaL mutations across different Prochlorococcus ecotypes could provide insights into how variations in this gene contribute to their diverse photosynthetic adaptations.

What methodologies are most effective for studying PsaL-mediated PSI trimerization in Prochlorococcus?

Studying PsaL-mediated PSI trimerization in Prochlorococcus requires a combination of structural, biochemical, and genetic approaches:

Structural methodologies:

TechniqueApplicationAdvantagesLimitations
X-ray crystallographyHigh-resolution structure determinationAtomic-level detail of PsaL interactionsRequires crystal formation
Cryo-electron microscopyNative structure visualizationPreserves membrane contextLower resolution than X-ray
Small-angle X-ray scatteringSolution-state structural analysisStudies dynamic assembliesLower resolution
Molecular dynamics simulationsPredict structural dynamicsModels interactions in silicoRequires validation

Biochemical approaches:

  • Blue-native PAGE: Analysis of intact PSI complexes from isolated thylakoid membranes can reveal the oligomeric state of PSI (monomers vs. trimers) and the effects of environmental conditions or genetic modifications on trimerization .

  • Sucrose gradient ultracentrifugation: Separation of PSI complexes based on size can be used to isolate and quantify monomeric and trimeric forms under different conditions.

  • Cross-linking studies: Chemical cross-linking followed by mass spectrometry can identify protein-protein interaction interfaces involved in PsaL-mediated trimerization.

  • Reconstitution experiments: In vitro reconstitution of PSI trimers using purified components can test the sufficiency of PsaL for trimerization and the effects of mutations.

Genetic methodologies:

  • Site-directed mutagenesis: Targeted mutations in key residues of PsaL can identify amino acids essential for trimerization .

  • Complementation studies: Expression of wild-type or mutant PsaL variants in psaL-deficient strains can test their ability to restore PSI trimerization.

  • Domain swapping: Creation of chimeric PsaL proteins by swapping domains between Prochlorococcus and other cyanobacteria can identify regions responsible for unique functional properties.

  • In vivo imaging: Fluorescently tagged PSI components can be used to visualize the dynamics of PSI complexes in living cells under different environmental conditions.

These methodologies, used in combination, can provide comprehensive insights into the structural basis, functional significance, and regulatory dynamics of PsaL-mediated PSI trimerization in Prochlorococcus.

Current Understanding and Knowledge Gaps

The research on Prochlorococcus marinus PsaL has revealed its essential role in photosystem I assembly and function, particularly in forming and stabilizing PSI trimers. Despite its anomalous length compared to PsaL proteins in other cyanobacteria, it maintains core functions while potentially conferring adaptations specific to the oceanic environment of Prochlorococcus . The post-transcriptional regulation of psaL by the small RNA PsrR1 provides a mechanism for rapidly adjusting photosynthetic apparatus composition in response to changing light conditions .

Significant knowledge gaps remain, particularly regarding the structural basis for the unique properties of Prochlorococcus PsaL, the functional implications of these differences for photosynthetic efficiency under various environmental conditions, and the evolutionary processes that have shaped these adaptations. The diversity of PsaL regulation and function across different Prochlorococcus ecotypes and its contribution to their ecological success also warrant further investigation .

Future Research Directions

Future research on Prochlorococcus PsaL should focus on several promising directions:

  • High-resolution structural studies of PSI complexes from different Prochlorococcus ecotypes to elucidate the structural basis for their functional adaptations.

  • Comparative functional analyses of PsaL across diverse Prochlorococcus strains to understand how variations contribute to their ecological strategies.

  • In-depth investigation of the regulatory network controlling psaL expression, including the role of small RNAs and transcription factors in response to environmental cues.

  • Examination of PsaL evolution within the context of the Prochlorococcus collective's adaptive radiation, using phylogenomic approaches to trace the emergence of specialized features.

  • Development of genetic manipulation techniques for Prochlorococcus to enable direct testing of PsaL function through targeted mutations and complementation studies.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.