Recombinant Prochlorococcus marinus Protein CrcB homolog 1 (crcB1)

Shipped with Ice Packs
In Stock

Description

Molecular Definition and Functional Context

Recombinant Prochlorococcus marinus Protein CrcB homolog 1 (crcB1) is a bioengineered protein derived from cyanobacterial genomes. It is annotated as a putative fluoride ion transporter and belongs to the CrcB family of proteins, which are implicated in ion transport and stress adaptation in marine phototrophs .

Key Molecular Attributes

AttributeDetailsSource
UniProt IDsQ7V938, P63862, Q46IH8 (strain-specific)
Gene SynonymscrcB1, PMT_0123, PMN2A_1210
Protein Length114–132 amino acids (strain-dependent)
AA SequenceExample: MGIDIKNNTFFLISLGAFLGALFRWQIDEIFIVNLIGCFLLGFFNSLNILKRYKLTLCVGLCGSMTTFSSWMSHLYKLLNQGLYKLFLLNSLSIVLMGVLSIALGHIFAKRLNA
TagN-terminal His-tag for purification

Production Workflow

  1. Cloning: Full-length crcB1 gene amplified from Prochlorococcus marinus genomic DNA.

  2. Expression: Induced in E. coli with T7 RNA polymerase systems.

  3. Purification: Ni-NTA affinity chromatography (His-tag) followed by lyophilization .

Role in Ion Transport

CrcB1 is hypothesized to mediate fluoride ion transport, though direct experimental validation is pending. Its structural homology to bacterial ion transporters suggests a conserved mechanism across cyanobacteria .

Ecological Adaptation

Prochlorococcus marinus ecotypes (e.g., MED4, NATL2A) exhibit strain-specific crcB1 sequences, correlating with niche specialization:

  • High-light (HL) strains: Enriched in stress-resistance genes (e.g., DNA repair, RNA processing) .

  • Low-light (LL) strains: Unique chlorophyll adaptations and ion transport proteins .

Genomic Context

  • Genome Size: ~1.75–1.66 Mbp in P. marinus, with minimal paralogous genes .

  • Gene Neighborhood: Co-occurs with endogenous viral elements and light-responsive operons .

Applications in Biological Research

ApplicationDescriptionSource
ELISA KitsUsed as antigen in immunoassays for detecting anti-crcB1 antibodies .
Functional StudiesInvestigates fluoride transport kinetics and membrane localization.
Comparative GenomicsAnalyzed in ORFeome libraries to map HL/LL ecotype adaptations .

Challenges and Future Directions

  1. Functional Validation: Direct biochemical assays (e.g., fluorometric ion uptake) required to confirm transport activity.

  2. Strain-Specific Variability: Sequence divergence (e.g., MIT9312 vs. NATL2A) impacts protein function and application .

  3. Systems Biology: Integration with synthetic ORFeomes (e.g., MED4, NATL1A) to study genotype-phenotype relationships .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order. We will prepare according to your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributors for specific delivery time estimates.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors such as storage conditions, buffer ingredients, temperature, and the intrinsic stability of the protein itself.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize its development.
Synonyms
crcB1; PMT9312_1725; PMT9312_1724; Putative fluoride ion transporter CrcB 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-109
Protein Length
full length protein
Species
Prochlorococcus marinus (strain MIT 9312)
Target Names
crcB1
Target Protein Sequence
MKIKIYIYILLACYIASFLRLFINNNFIVSIIGSLLFGFFIDKRLSYSIEKIILSGFFSC FTSFSGFIYFLYKVFNQGDLMKFIIFCNLIIIINLLVMYFGFWISRKIT
Uniprot No.

Target Background

Function
CrcB homolog 1 (crcB1) is crucial in reducing fluoride concentration within the cell, thereby mitigating its toxicity.
Database Links
Protein Families
CrcB (TC 9.B.71) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Prochlorococcus marinus Protein CrcB homolog 1 (crcB1)?

CrcB homolog 1 (crcB1) is a membrane protein from the marine cyanobacterium Prochlorococcus marinus, classified as a putative fluoride ion transporter. The protein consists of 109 amino acids with a molecular structure that facilitates transmembrane ion movement. Recombinant versions typically incorporate an N-terminal histidine tag to facilitate purification and detection in experimental systems. The protein's hydrophobic regions indicate multiple transmembrane domains, consistent with its role in ion transport across cellular membranes. This protein belongs to a family of fluoride channels that are widely distributed across bacteria, archaea, and eukaryotes, highlighting their evolutionary significance in cellular homeostasis and ion regulation .

What is the physiological significance of fluoride transport in marine cyanobacteria?

Fluoride transport mechanisms are essential for Prochlorococcus marinus and other marine cyanobacteria as protective systems against environmental toxicity. In ocean environments, fluoride concentrations can vary significantly, and these microorganisms have evolved specialized transport systems to maintain appropriate intracellular fluoride levels. The CrcB family of transporters, including CrcB1, functions primarily to export fluoride ions that enter the cell, thereby preventing the inhibition of essential enzymes sensitive to fluoride. This protective mechanism is particularly crucial for Prochlorococcus as the most abundant photosynthetic organism in ocean environments, where its metabolic processes must continue unimpeded by fluoride toxicity. The evolutionary conservation of these transporters across diverse microbial lineages underscores their fundamental importance in cellular homeostasis.

How is recombinant CrcB1 protein typically expressed and purified?

Recombinant CrcB1 from Prochlorococcus marinus is optimally expressed using E. coli expression systems with careful consideration of membrane protein production challenges. The standard protocol involves:

  • Cloning the crcB1 gene into an expression vector that incorporates an N-terminal His-tag for purification

  • Transforming the construct into an E. coli expression strain optimized for membrane proteins

  • Inducing expression under controlled temperature conditions (typically lower than standard to prevent inclusion body formation)

  • Cell lysis followed by membrane fraction isolation

  • Solubilization of membrane proteins using appropriate detergents

  • Affinity chromatography using the His-tag for initial purification

  • Secondary purification steps such as size exclusion chromatography

The expression in E. coli has proven successful, yielding protein with greater than 90% purity as determined by SDS-PAGE analysis. The critical considerations include detergent selection for solubilization and maintaining the cold chain throughout purification to preserve protein stability and function .

What are the optimal storage conditions for maintaining CrcB1 stability?

For maximum stability and retention of functional activity, recombinant CrcB1 protein requires specific storage conditions:

  • The purified protein is typically supplied as a lyophilized powder, which provides maximum stability during shipping and long-term storage

  • Upon receipt, the protein should be stored at -20°C/-80°C, with -80°C preferred for longer-term storage

  • For reconstitution, deionized sterile water should be used to reach a concentration of 0.1-1.0 mg/mL

  • Addition of glycerol to a final concentration of 50% is recommended for prevention of freeze-thaw damage

  • After reconstitution, the solution should be aliquoted to avoid repeated freeze-thaw cycles

  • Working aliquots can be stored at 4°C for up to one week

The storage buffer typically consists of a Tris/PBS-based buffer containing 6% trehalose at pH 8.0, which has been optimized to maintain protein stability. Repeated freeze-thaw cycles significantly reduce protein activity and should be strictly avoided. Proper centrifugation of the vial before opening is advised to ensure all material is collected at the bottom .

What reconstitution methods are most effective for functional studies of CrcB1?

For functional studies of CrcB1, reconstitution into membrane mimetics is essential to maintain native-like activity. Effective reconstitution methods include:

  • Initial reconstitution in detergent micelles:

    • Use mild detergents such as DDM (n-Dodecyl β-D-maltoside) or LMNG (Lauryl maltose neopentyl glycol)

    • Maintain a detergent concentration above CMC (critical micelle concentration)

    • Buffer composition: Tris/PBS-based buffer, pH 8.0 with 6% trehalose

  • Reconstitution into proteoliposomes:

    • Mix detergent-solubilized CrcB1 with preformed liposomes composed of E. coli lipids or synthetic lipid mixtures

    • Remove detergent gradually using adsorbent beads or dialysis

    • Confirm incorporation using density gradient centrifugation

  • Reconstitution into nanodiscs for structural studies:

    • Combine CrcB1 with appropriate membrane scaffold proteins and lipids

    • Remove detergent to form discrete nanodiscs containing the protein

    • Purify the resultant protein-nanodisc complexes by size exclusion chromatography

The reconstituted protein should be validated for proper folding and orientation using circular dichroism spectroscopy and fluorescence-based transport assays to confirm functional integrity. For all reconstitution methods, it's critical to maintain sample temperature below 4°C during the process to prevent protein aggregation .

How can site-directed mutagenesis be applied to investigate CrcB1 transport mechanisms?

Site-directed mutagenesis represents a powerful approach for dissecting the molecular mechanisms of CrcB1-mediated fluoride transport. This methodology can systematically target:

  • Conserved residues within the transmembrane regions:

    • Mutation of conserved polar residues that likely line the ion conduction pathway

    • Alteration of charged residues that may contribute to ion selectivity

    • Substitution of glycine residues that might facilitate conformational changes

  • Potential gating regions:

    • N-terminal and C-terminal modifications to assess their role in channel regulation

    • Mutation of residues at predicted constriction points based on structural modeling

  • Oligomerization interfaces:

    • Targeted mutations at protein-protein interaction surfaces to disrupt multimerization

    • Introduction of cysteine residues for cross-linking studies to validate structural models

The experimental protocol should include:

  • Generation of mutant constructs using standard PCR-based methods

  • Expression and purification under identical conditions as wild-type

  • Comparative functional assays using fluoride-sensitive electrodes or fluorescent indicators

  • Structural characterization using CD spectroscopy to confirm proper folding

Data tables comparing transport rates, ion selectivity, and inhibitor sensitivity between wild-type and mutant proteins can provide mechanistic insights into the function of specific residues in the transport process. This systematic approach can elucidate the molecular basis of ion selectivity and transport kinetics in CrcB1.

What techniques are available for assessing CrcB1 fluoride transport activity in vitro?

Several sophisticated techniques can be employed to quantitatively assess the fluoride transport activity of reconstituted CrcB1:

  • Fluoride-selective electrode measurements:

    • Real-time monitoring of fluoride concentration changes

    • Application in proteoliposome systems with internal vs. external concentration gradients

    • Quantification of transport rates under various conditions

  • Fluorescence-based assays:

    • Utilization of fluoride-quenchable fluorophores entrapped in proteoliposomes

    • Measurement of fluorescence changes corresponding to fluoride influx/efflux

    • High-throughput screening capability for inhibitor studies

  • Isotope flux assays:

    • Use of 18F-labeled fluoride to track transport with high sensitivity

    • Scintillation counting for quantitative measurement

    • Application in kinetic studies of transport rates

  • Patch-clamp electrophysiology:

    • Direct measurement of channel conductance in planar lipid bilayers

    • Single-channel recordings to characterize gating properties

    • Assessment of voltage-dependence of transport activity

A standardized experimental setup should include appropriate controls:

  • Empty proteoliposomes without protein

  • Proteoliposomes with denatured CrcB1

  • Known fluoride channel inhibitors as reference compounds

The following data table format can be used to record and compare transport activities:

Experimental ConditionInitial Transport Rate (nmol/min/mg)Km for F- (mM)Vmax (nmol/min/mg)Inhibition Profile
Wild-type CrcB1[value][value][value][compounds & IC50]
Mutant variants[value][value][value][compounds & IC50]
pH dependence[values at different pH][values][values][compounds & IC50]

What structural biology approaches are most promising for CrcB1 characterization?

Several structural biology techniques show promise for elucidating the three-dimensional architecture of CrcB1:

For each technique, specific sample preparation considerations for CrcB1 include:

  • Detergent screening to identify optimal solubilization conditions

  • Lipid composition optimization when reconstituting into mimetic systems

  • Protein stability assessment throughout the purification and preparation processes

What are common challenges in CrcB1 expression and purification, and how can they be addressed?

Researchers frequently encounter several challenges when working with CrcB1, a membrane protein with multiple transmembrane domains:

  • Low expression yields:

    • Problem: Membrane protein overexpression can be toxic to host cells

    • Solution: Use tunable expression systems with lower induction levels

    • Solution: Test multiple E. coli strains specialized for membrane proteins (C41, C43, Lemo21)

    • Solution: Optimize growth temperature (typically 18-25°C) and induction time

  • Protein aggregation:

    • Problem: Hydrophobic regions promote aggregation during extraction

    • Solution: Screen multiple detergents at various concentrations

    • Solution: Include stabilizing agents such as glycerol (10-20%) during extraction

    • Solution: Perform all purification steps at 4°C with protease inhibitors

  • Poor solubilization:

    • Problem: Inefficient extraction from membranes

    • Solution: Optimize detergent:protein ratio

    • Solution: Test different solubilization times (2-24 hours)

    • Solution: Consider detergent mixtures rather than single detergents

  • Purification challenges:

    • Problem: Co-purification of contaminants

    • Solution: Include imidazole wash steps during His-tag purification

    • Solution: Implement secondary purification steps (ion exchange, size exclusion)

    • Solution: Consider on-column detergent exchange during purification

A systematic troubleshooting approach can be documented using the following format:

ChallengeSymptomsPotential CausesOptimization StrategiesValidation Method
Low yield<0.5mg/L cultureToxicity, inclusion bodiesLower temperature, specialized strainsWestern blot, SDS-PAGE
AggregationPrecipitation, void volume in SECDetergent mismatch, temperature effectsDetergent screening, buffer optimizationDynamic light scattering
Loss of activityReduced F- transportDenaturation, improper foldingStabilizing additives, gentle purificationTransport assays

This methodical approach to troubleshooting ensures that each challenge is addressed systematically rather than through trial and error, leading to more consistent and reliable protein preparation .

How can researchers validate the proper folding and functionality of purified CrcB1?

Validating proper folding and functionality of CrcB1 requires a multi-faceted approach:

Data integration is critical for comprehensive validation, with results compiled in the following format:

Validation MethodParameter MeasuredExpected ResultAcceptance CriteriaTroubleshooting if Failed
CD Spectroscopyα-helical content>60%Within 10% of predictionAdjust reconstitution conditions
Transport AssayF- flux rate>50 nmol/min/mgSignificant vs. control liposomesCheck reconstitution efficiency
SEC-MALSOligomeric stateDimer/tetramerMonodisperse peakOptimize detergent/lipid ratio

This multi-parameter validation approach ensures that the purified CrcB1 is properly folded and retains its native functional properties before proceeding with advanced experimental applications .

What controls should be included in CrcB1 functional assays to ensure reliable data interpretation?

Robust experimental design for CrcB1 functional assays requires comprehensive controls:

  • Negative controls:

    • Empty proteoliposomes without CrcB1

    • Proteoliposomes with heat-denatured CrcB1

    • Proteoliposomes with an unrelated membrane protein

    • Buffers alone to assess baseline drift in measurements

  • Positive controls:

    • Proteoliposomes with a known fluoride transporter (if available)

    • Artificial fluoride ionophores to confirm assay functionality

    • Calibration standards for quantitative measurements

  • Specificity controls:

    • Competitive assays with other halides (Cl-, Br-, I-)

    • pH variations to assess proton coupling

    • Membrane potential manipulation to test electrogenic transport

  • Technical controls:

    • Multiple protein batches to assess reproducibility

    • Different reconstitution protocols to confirm consistent activity

    • Time-course measurements to ensure linearity of initial rates

    • Protein concentration dependency to confirm specific activity

Data analysis should include statistical validation:

  • Minimum of triplicate measurements for each condition

  • Calculation of standard deviation and standard error

  • Statistical significance testing between experimental conditions

  • Regression analysis for kinetic parameters

A typical experimental design table would include:

Control TypeSpecific ControlPurposeExpected OutcomeInterpretation if Different
NegativeEmpty liposomesBackground leakageMinimal F- movementLeaky membranes or contamination
PositiveIonophoreAssay functionalityRapid F- equilibrationAssay technical failure
SpecificityCl- competitionIon selectivityMinimal effect on F- transportNon-specific channel activity
TechnicalProtein concentration seriesLinearityLinear relationship with activityOligomerization or saturation effects

This comprehensive approach to controls ensures that the measured transport activity can be confidently attributed to properly functioning CrcB1 protein rather than experimental artifacts or non-specific effects.

What are the unresolved questions about CrcB1 structure-function relationships?

Despite advances in our understanding of CrcB1, several critical questions remain unresolved:

  • Ion selectivity mechanism:

    • What specific amino acid residues form the selectivity filter for fluoride?

    • How does CrcB1 discriminate between fluoride and other halides?

    • Is water co-transported and what is its role in the transport mechanism?

    • What is the precise stoichiometry of ion transport?

  • Conformational dynamics:

    • What conformational changes occur during the transport cycle?

    • Are there distinct open, closed, and intermediate states?

    • What triggers the conformational transitions between states?

    • How do lipid interactions modulate conformational dynamics?

  • Regulatory mechanisms:

    • Does CrcB1 activity respond to environmental signals?

    • Are there endogenous inhibitors or activators of transport?

    • Does post-translational modification play a role in regulation?

    • How is CrcB1 expression regulated in response to environmental fluoride levels?

  • Evolutionary aspects:

    • How has CrcB1 function diverged across different bacterial species?

    • What structural adaptations exist in extremophile versions of the protein?

    • Is there evidence for co-evolution with other cellular systems?

Future research should address these questions using integrated approaches combining:

  • High-resolution structural determination methods

  • Advanced molecular dynamics simulations

  • Systematic mutagenesis coupled with functional assays

  • Comparative studies across the CrcB family from diverse organisms

These investigations will not only enhance our understanding of CrcB1 specifically but also contribute to broader knowledge of ion channel/transporter mechanisms and evolution.

How might advanced techniques in membrane protein research be applied to CrcB1 studies?

Emerging technologies in membrane protein research offer new opportunities for CrcB1 investigation:

Implementation strategy for CrcB1 research:

  • Begin with computational predictions to guide experimental design

  • Apply complementary structural techniques at different resolution levels

  • Validate structural models with targeted functional assays

  • Integrate findings into comprehensive mechanistic models

These advanced techniques promise to resolve long-standing questions about CrcB1 function that have been resistant to traditional approaches, potentially revealing novel mechanisms of ion selectivity and transport.

What comparative studies between CrcB homologs could advance understanding of fluoride transport mechanisms?

Comparative studies across the CrcB family present powerful opportunities to elucidate fundamental principles of fluoride transport:

  • Evolutionary analysis:

    • Phylogenetic comparison of CrcB homologs across different domains of life

    • Identification of conserved residues that predict essential functional roles

    • Correlation of sequence variations with habitat fluoride concentrations

    • Expected outcome: Identification of the minimal conserved machinery required for fluoride transport

  • Structure-function relationships:

    • Comparison of CrcB1 with structurally characterized CrcB homologs

    • Functional characterization of chimeric constructs between homologs

    • Restoration of function experiments in CrcB knockout organisms

    • Expected outcome: Mapping of sequence diversity to functional variations

  • Adaptation to environmental conditions:

    • Comparison of CrcB proteins from extremophiles vs. mesophiles

    • Analysis of homologs from fluoride-rich environments

    • Study of adaptations in organisms facing fluctuating fluoride levels

    • Expected outcome: Understanding adaptive mechanisms for different fluoride environments

A systematic comparative approach would include:

Species SourceHabitat F- ConcentrationSequence Identity to P. marinus CrcB1Key Sequence VariationsFunctional DifferencesStructural Adaptations
Marine organisms~1.3 ppm100% (reference)N/AReference activityReference structure
Freshwater organisms<0.5 ppm[%][variations][differences][adaptations]
Fluoride-rich environments>5 ppm[%][variations][differences][adaptations]
Extremophiles[concentration][%][variations][differences][adaptations]

This comparative framework allows for systematic correlation of sequence, structure, and functional properties across evolutionary diverse homologs, potentially revealing fundamental principles of fluoride channel function that transcend individual family members.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.