Recombinant Prochlorococcus marinus Protein translocase subunit SecD (secD)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have any specific format requirements, please indicate them during order placement. We will accommodate your request to the best of our ability.
Lead Time
Delivery time may vary based on the purchase method and location. For specific delivery times, please consult your local distributor.
Please note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For short-term storage, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein.
Generally, the shelf life for liquid form is 6 months at -20°C/-80°C. The shelf life for lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type preference, please communicate it to us, and we will prioritize its development.
Synonyms
secD; Pro_0767; Protein translocase subunit SecD
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-494
Protein Length
full length protein
Species
Prochlorococcus marinus (strain SARG / CCMP1375 / SS120)
Target Names
secD
Target Protein Sequence
MARQQGWFALLIALVISAFLLCINLPFQLGLDLRGGSQLTLEVQALNPNEQIKSEQLEAV QSVLDRRVNGLGVAESSLRTIGTNQLILELPGEQEPSKAARVLGKTALLEFRKQKINTKS EMQRLQRIRSQVNNIDLYKKASKDNKSELIENKKIGEQVNDLRVALGLANSSLNEHDQID QIRQKVNSEIVELFEPSSLTGSDLVSAGRRQEQNLTSWEVTLAFNQDGGEKFASLTKSIA GSDRLLGIILDGESISEASVGEQFKVAGITGGSATISGNFTAESARELEVQLRGGSLPLP VSIVQVRTIGPTLGVDNIRRSLIAALLGLSLVAIFMVSFYRLAGFIAIFALSFYALFNIA IYALIPVTLTLPGVAGFVLSIGMAVDANVLIFERVKDELRRGNTLIRSIETGFSQAFSSI IDGHITTLISCISLFYLGTGFVKGFAATLGIGVFISLFTALSCTRVLLRFFMSYKSLRKT TNFLSENQLPKQLT
Uniprot No.

Target Background

Function
SecD is a component of the Sec protein translocase complex. It interacts with the SecYEG preprotein conducting channel. SecDF utilizes the proton motive force (PMF) to complete protein translocation after the ATP-dependent function of SecA. It is likely involved in protein translocation into and across both the cytoplasmic and thylakoid membranes in cyanobacterial cells.
Database Links
Protein Families
SecD/SecF family, SecD subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the protein translocase subunit SecD in Prochlorococcus marinus?

SecD is a critical component of the Sec protein translocation machinery in Prochlorococcus marinus. It functions as part of a membrane-embedded complex that facilitates protein export across the cytoplasmic membrane. In P. marinus strain SARG/CCMP1375/SS120, SecD (Uniprot: Q7VCH3) consists of 494 amino acids and plays a crucial role in maintaining the proton motive force required for efficient protein translocation .

How does SecD differ between Prochlorococcus ecotypes?

Prochlorococcus exists in multiple ecotypes adapted to different light conditions and oceanic regions. High-light adapted strains (like MED4) and low-light adapted strains (like MIT9313) show variations in their secD genes reflective of their genomic adaptations. Low-light strains typically maintain larger genomes with different G+C content compared to high-light strains, which may affect secD codon usage and structure . The gene content and organization around secD can vary between ecotypes, potentially affecting its regulation and function in different ocean environments.

What are the optimal conditions for expressing recombinant Prochlorococcus marinus SecD in E. coli?

Based on successful protocols for expressing other Prochlorococcus proteins:

Expression Protocol:

  • Clone the secD gene (Q7VCH3) into an expression vector with a T7 promoter system

  • Transform into E. coli BL21(DE3)/pLysS cells

  • Grow cultures at 37°C until OD600 reaches 0.6-0.8

  • Induce with 0.5-1.0 mM IPTG

  • Shift temperature to 18-20°C

  • Continue expression for 16-20 hours

  • Harvest cells by centrifugation at 5000g for 15 min

This protocol has been successful for other membrane proteins from marine cyanobacteria, with modifications for SecD focusing on lower induction temperatures to enhance proper folding of this membrane protein .

How can I optimize purification of Prochlorococcus SecD for structural studies?

For membrane proteins like SecD:

Purification Protocol:

  • Resuspend cells in buffer containing 50 mM Tris-HCl pH 8.0, 300 mM NaCl, 10% glycerol

  • Add detergent (recommended: 1% DDM or LMNG) for solubilization

  • Incubate with gentle rotation at 4°C for 1-2 hours

  • Clear lysate by centrifugation at 40,000g for 45 min

  • Purify using Ni-NTA affinity chromatography if His-tagged

  • Apply size exclusion chromatography for final purification

  • Store in Tris-based buffer with 50% glycerol at -20°C for short-term or -80°C for extended storage

Protein yield typically ranges from 1-3 mg per liter of culture, with purity >90% achievable through this method.

What isotope labeling strategies work best for NMR studies of Prochlorococcus SecD?

For NMR studies, adapt methods used successfully for other cyanobacterial membrane proteins:

  • Use M9 minimal media supplemented with 15NH4Cl (1 g/L) for 15N labeling

  • For 13C labeling, use 13C-glucose (2-4 g/L) as the sole carbon source

  • For deuteration, prepare media in D2O with deuterated carbon sources

  • Use the E. coli BL21(DE3) expression system with the following modifications:

    • Extend growth time by 50% in minimal media

    • Reduce induction temperature to 16°C

    • Extend expression time to 24-36 hours

This approach has been validated for other Prochlorococcus proteins and yielded sufficient labeled protein for NMR analysis .

How can I assess the protein translocation activity of recombinant SecD in vitro?

In vitro Translocation Assay:

  • Prepare inverted membrane vesicles containing SecD and other Sec components

  • Express and purify a model pre-protein substrate with a SecB-dependent signal sequence

  • Set up reaction mixture:

    • 50 μl inverted membrane vesicles

    • 5 μg pre-protein substrate

    • 5 μg SecB

    • 5 μg SecA

    • ATP regeneration system (10 mM creatine phosphate, 0.5 μg creatine kinase)

    • 2 mM ATP

    • Buffer: 50 mM HEPES-KOH pH 7.5, 100 mM KCl, 5 mM MgCl2

  • Incubate at 37°C for 30 minutes

  • Stop reaction with 10% TCA

  • Analyze by SDS-PAGE and Western blotting

Activity is measured by the protection of translocated protein from proteinase K digestion in the vesicles .

How does Prochlorococcus SecD interact with other components of the Sec machinery?

Research indicates that SecD forms a complex with SecF and potentially interacts with YidC in the membrane. To study these interactions:

Protein-Protein Interaction Analysis Methods:

  • Co-immunoprecipitation: Using antibodies against SecD to pull down interaction partners

  • Bacterial two-hybrid assays: Fusing SecD and potential partners to complementary fragments of adenylate cyclase

  • Pull-down assays: Using purified His-tagged SecD with cell lysates

  • FRET analysis: For in vivo studies of protein-protein interactions

  • Cross-linking experiments: Using formaldehyde or DSP followed by mass spectrometry

These approaches help elucidate the protein-protein interaction network of SecD within the Prochlorococcus translocation machinery .

How does Prochlorococcus SecD compare to SecD in other cyanobacteria and E. coli?

Comparative Analysis of SecD Proteins:

OrganismSecD Length (aa)% Identity to P. marinus SecDNotable Features
P. marinus SS120494100%Adapted to low-light environment, low G+C content
Marine Synechococcus~510-52065-70%Higher G+C content, larger genome
E. coli61532%Larger protein with extended C-terminal domain
Freshwater Synechocystis~50555-60%Different environmental adaptation

Key differences include:

  • P. marinus SecD is shorter than E. coli homologs, consistent with genome minimization trends

  • Codon usage biases toward A/T at the third position (T>A>C>G) in P. marinus, reflective of its low G+C content genome

  • Functional domains show conservation, but loop regions vary significantly

  • Lower G+C content in P. marinus SecD compared to freshwater cyanobacteria

What evolutionary adaptations are evident in the SecD gene within the Prochlorococcus lineage?

The SecD gene in Prochlorococcus shows evidence of:

The secD gene generally follows the evolutionary patterns seen in whole-genome phylogenetic analyses, with distinct clustering between high-light and low-light adapted strains .

How can SecD be used as a target for studying protein translocation mechanisms in minimal genomes?

Prochlorococcus possesses one of the smallest genomes among free-living organisms (1.66-1.75 MB), making it an excellent model for studying essential cellular processes in a minimal system . For investigating protein translocation:

  • Comparative genomics approach: Analyze SecD across Prochlorococcus ecotypes to identify essential vs. variable regions

  • Minimal functional unit determination: Through systematic domain deletion and functional assays

  • Synthetic biology applications: Using P. marinus SecD to build minimal translocation systems

  • Evolutionary studies: Investigating how protein translocation machinery evolved in streamlined genomes

Research protocols should combine structural studies (X-ray crystallography, cryo-EM) with functional assays to correlate structure with function in this minimal system.

How does the SecD function relate to Prochlorococcus ecological adaptation and global distribution?

SecD function may contribute to Prochlorococcus adaptation through:

  • Membrane protein insertion efficiency: Different ecotypes require specific membrane protein compositions for adapting to varying light levels and nutrient conditions

  • Stress response: Efficient protein translocation is crucial for responding to environmental stressors common in oligotrophic environments

  • Metabolic adaptations: SecD facilitates insertion of transporters like Pro1404 (glucose transporter) that allow nutritional flexibility

  • Vesicle formation: SecD may influence extracellular vesicle production, which has been observed in Prochlorococcus as a mechanism for intercellular communication

Research approaches should combine field studies of natural populations with laboratory experiments on defined strains to correlate SecD function with ecological adaptations.

How can I address low yield issues when expressing Prochlorococcus SecD?

Common challenges with SecD expression include:

  • Membrane protein toxicity: Use C41/C43 E. coli strains specifically engineered for membrane protein expression

  • Codon usage differences: Consider codon optimization for E. coli expression or use Rosetta strains

  • Protein aggregation: Lower expression temperature to 16°C and reduce IPTG concentration to 0.1-0.2 mM

  • Protease degradation: Add protease inhibitors (PMSF, leupeptin, pepstatin) during extraction

  • Solubilization efficiency: Test different detergents (DDM, LMNG, DMNG) for optimal solubilization

Optimized Protocol for Difficult Cases:

  • Use autoinduction media instead of IPTG induction

  • Harvest cells earlier (OD600 = 3-4)

  • Include 10% glycerol in all buffers

  • Add 5 mM β-mercaptoethanol to reduce disulfide bond formation

  • Consider fusion partners like MBP or SUMO to enhance solubility

What methods can be used to study SecD in native Prochlorococcus cells given their challenging laboratory cultivation?

Prochlorococcus is notoriously difficult to culture, particularly in axenic conditions. For studying SecD in native contexts:

  • Helper bacteria approach: Use Alteromonas strains as helper bacteria for cultivation as described by Chen et al.

  • Genomic tagging: Develop methods based on recent genetic transformation advances using transposable elements in Prochlorococcus

  • Filter cultivation: Use filter-sterilized seawater media supplemented with key nutrients

  • Proteomic approaches: Isolate native membrane fractions and use mass spectrometry to analyze SecD and interacting partners

  • Transcriptomic analysis: Use RNA-Seq to monitor secD expression under different conditions

Researchers should note that laboratory cultivation conditions differ significantly from oceanic environments, which may affect SecD expression and function.

How might CRISPR/Cas9 technologies be adapted for targeting SecD in Prochlorococcus?

Recent advances in cyanobacterial genetics suggest potential approaches:

  • Use agar stab mating techniques to introduce DNA as described by Laurenceau et al.

  • Develop species-specific delivery vectors based on successful transformations in related species

  • Optimize electroporation protocols specifically for Prochlorococcus (23.5 kV/cm field strength with 25 μF capacitance)

  • Consider targeted gene replacement strategies rather than CRISPR editing initially

  • Implement microfluidic systems to enhance transformation efficiency for individual cells

Current limitations include:

  • Low transformation efficiency in Prochlorococcus

  • Poor survival of cells during electroporation procedures

  • Limited selectable markers for marine cyanobacteria

  • Challenges in achieving homologous recombination

What is the relationship between SecD function and extracellular vesicle formation in Prochlorococcus?

Recent research has shown that Prochlorococcus produces extracellular vesicles that contain diverse biomolecules . The role of SecD in this process represents an emerging research direction:

  • SecD may contribute to membrane protein composition that influences vesicle budding

  • Protein cargo selection for vesicles might involve SecD-dependent pathways

  • Comparative analysis between high-light and low-light strains shows differences in vesicle composition that may relate to differences in their protein translocation systems

Research Methodology:

  • Compare vesicle production in strains with different SecD expression levels

  • Analyze the proteome of vesicles to identify SecD-dependent cargo

  • Use fluorescently tagged SecD to visualize potential involvement in vesicle formation sites

This represents a frontier in understanding how fundamental cellular processes like protein translocation connect to emerging ecological functions like vesicle-mediated communication in marine ecosystems.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.