Recombinant Prochlorococcus marinus Protein translocase subunit SecF (secF)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you require a specific format, please indicate your preference during order placement. We will prepare according to your request.
Lead Time
Delivery times may vary based on the purchase method and location. Please contact your local distributors for specific delivery information.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors such as storage state, buffer ingredients, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
secF; Pro_0768; Protein translocase subunit SecF
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-321
Protein Length
full length protein
Species
Prochlorococcus marinus (strain SARG / CCMP1375 / SS120)
Target Names
secF
Target Protein Sequence
MSFTPKNLNVKYTFNVSRNRSKVWLISGFAVLISFLGFFFSWTNQSIGFPLRPGFDFTGG TQIILERKCDSECNKITTINISEAFNNAKFSNQETSQKLFDARIQFLDGYKSLLIRSPEL SPSESKEVIESIEFVAGPLEDGGQSVESIGPTLGAKLLQTTLISLLVAFSCVAIYISIRF DRMFSLYALLALFHDVLIVCGVFSWLGIINEVEVNSLFAVALLTIAGYSVNDTVVVFDRI REINKQESRMNFKQKVDFAVSATLTRTLYTSGTTLLPLIALIFFGGTTLYWFAIALALGV VVGSWSSIALVPSLLTLRKEN
Uniprot No.

Target Background

Function
SecF is a component of the Sec protein translocase complex. It interacts with the SecYEG preprotein conducting channel. SecDF utilizes the proton motive force (PMF) to complete protein translocation after the ATP-dependent function of SecA. It likely participates in protein translocation into and across both the cytoplasmic and thylakoid membranes in cyanobacterial cells.
Database Links
Protein Families
SecD/SecF family, SecF subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Prochlorococcus marinus Protein translocase subunit SecF and what is its primary function?

Protein translocase subunit SecF (secF) is a critical component of the Sec protein translocation system in Prochlorococcus marinus. The SecF protein functions as part of the SecYEG-SecDF complex, which facilitates the transport of proteins across the cytoplasmic membrane. In this system, SecF works cooperatively with SecD to enhance protein translocation by functioning as a membrane-integrated molecular motor that utilizes the proton motive force to drive protein transport .

The protein plays an essential role in the posttranslational targeting of proteins to the bacterial membrane, affecting both the efficiency and fidelity of protein secretion in this marine cyanobacterium. Recent research indicates that SecF contributes to the proper folding of transported proteins on the periplasmic side of the membrane .

What expression systems are most effective for producing recombinant Prochlorococcus marinus SecF?

E. coli is the predominant expression system used for recombinant production of Prochlorococcus marinus SecF. According to available data, expression in E. coli with an N-terminal His-tag provides good yields of functional protein . The expression protocol typically includes:

  • Transformation of E. coli expression strains (such as BL21(DE3)) with a plasmid containing the secF gene with an N-terminal His-tag

  • Culture growth at moderate temperatures (typically 30°C) to reduce inclusion body formation

  • Induction with IPTG at reduced concentrations (0.1-0.5 mM) when cultures reach mid-log phase

  • Extended expression periods (16-20 hours) at lower temperatures (16-18°C) post-induction

This approach helps balance protein yield with proper folding, which is particularly important for membrane proteins like SecF .

What purification strategies yield the highest purity recombinant SecF protein?

Purification of recombinant His-tagged Prochlorococcus marinus SecF typically follows a multi-step process:

Purification StepMethodConditionsPurpose
Initial captureNi-NTA affinity chromatographyBuffer containing 20-50 mM imidazoleCapture His-tagged SecF
Intermediate purificationSize exclusion chromatographyTris/PBS-based buffer, pH 8.0Remove aggregates and contaminants
Final polishingIon exchange chromatographySalt gradient elutionAchieve >90% purity
Storage preparationBuffer exchangeTris/PBS with 6% trehalose, pH 8.0Stabilize for storage

Addition of mild detergents (0.1-0.5% DDM or LDAO) throughout the purification process is essential for maintaining the solubility of this membrane protein. The final product typically achieves greater than 90% purity as determined by SDS-PAGE analysis .

How should purified SecF be stored to maintain optimal activity?

To maintain the structural integrity and activity of purified Prochlorococcus marinus SecF protein:

  • Store the lyophilized powder at -20°C/-80°C upon receipt

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (with 50% being optimal)

  • Aliquot into single-use volumes to avoid repeated freeze-thaw cycles

  • Store working aliquots at 4°C for up to one week

  • Store long-term aliquots at -20°C/-80°C

Repeated freeze-thaw cycles should be avoided as they significantly reduce protein activity. For experiments requiring active protein, freshly thawed aliquots should be used whenever possible .

How can recombinant SecF be used to study protein translocation mechanisms?

Recombinant Prochlorococcus marinus SecF can be employed in several experimental approaches to study protein translocation:

  • In vitro translocation assays: Reconstituting purified SecF along with other Sec components (SecY, SecE, SecD) into proteoliposomes allows for controlled studies of translocation activity using radiolabeled or fluorescently tagged substrate proteins.

  • SecF-substrate interaction analysis: Techniques such as surface plasmon resonance (SPR) or microscale thermophoresis (MST) can measure binding kinetics between SecF and various substrate proteins.

  • Cross-linking studies: Chemical cross-linking followed by mass spectrometry analysis can identify specific regions of SecF that interact with substrate proteins during translocation.

  • Complementation assays: Using SecF-deficient bacterial strains complemented with Prochlorococcus marinus SecF to assess functional conservation across species .

These approaches provide insights into how SecF contributes to the efficiency and specificity of protein translocation in Prochlorococcus marinus, which is particularly relevant given this organism's ecological importance in marine ecosystems .

What experimental controls should be included when studying SecF function?

When designing experiments with recombinant Prochlorococcus marinus SecF, the following controls should be incorporated:

Control TypeImplementationPurpose
Negative controlsHeat-inactivated SecFConfirm activity is protein-specific
Substrate controlsKnown SecF substrates vs. non-substratesVerify substrate specificity
System controlsReconstituted systems with all Sec components vs. systems lacking individual componentsAssess contribution of SecF to the complete translocation process
Mutational controlsPoint mutations in key residues of SecFIdentify functionally important regions
Physiological controlsExperiments at different pH and salt concentrationsMimic the marine environment of Prochlorococcus

Additionally, when studying posttranslational targeting mechanisms, controls that distinguish between co-translational and post-translational pathways should be included to accurately characterize SecF's role in these processes .

How does Prochlorococcus marinus SecF compare structurally and functionally with SecF proteins from other bacterial species?

While the fundamental function of SecF is conserved across bacterial species, Prochlorococcus marinus SecF exhibits adaptations that likely reflect the unique environmental conditions this marine cyanobacterium faces:

  • Sequence conservation: Prochlorococcus marinus SecF shares approximately 30-40% sequence identity with SecF proteins from model organisms like E. coli, with higher conservation in the transmembrane regions and functional domains.

  • Salt adaptation: The protein contains a higher proportion of acidic residues on its surface compared to SecF from freshwater or terrestrial bacteria, potentially representing an adaptation to the marine environment.

  • Temperature sensitivity: Functional studies suggest that Prochlorococcus marinus SecF maintains activity at lower temperatures compared to homologs from mesophilic bacteria, reflecting adaptation to its oceanic habitat.

  • Interaction partners: The interaction between SecF and SecD appears to be conserved, but differences in the periplasmic domains suggest potential differences in substrate handling.

These differences may reflect the evolution of the Sec system to accommodate the specific physiological requirements of Prochlorococcus marinus in its oligotrophic ocean environment .

What approaches can be used to study the role of SecF in Prochlorococcus marinus ecology?

Understanding the ecological significance of SecF in Prochlorococcus marinus requires integrating molecular studies with ecological contexts:

  • Strain-specific expression analysis: Compare secF expression levels across different Prochlorococcus ecotypes (high-light vs. low-light adapted strains) to determine if SecF function varies with environmental adaptation.

  • Environmental stress responses: Examine how changes in temperature, light intensity, and nutrient availability affect SecF expression and function, particularly in relation to the production of exopolymeric substances like TEP (Transparent Exopolymer Particles) that contribute to marine carbon cycling .

  • Metaproteomic approaches: Analyze the SecF-dependent secretome of Prochlorococcus in natural communities compared to laboratory cultures to identify environmentally relevant transport substrates.

  • Genetic manipulation: Use CRISPR-Cas systems adapted for cyanobacteria to create SecF variants in Prochlorococcus, followed by phenotypic characterization under various environmental conditions.

These approaches can help connect molecular mechanisms of protein translocation to the ecological success of Prochlorococcus as one of the most abundant photosynthetic organisms in oligotrophic oceans .

How can researchers address solubility challenges when working with recombinant SecF?

As a membrane protein, SecF presents significant solubility challenges that can be addressed through multiple strategies:

  • Detergent screening: Systematically evaluate different detergents for their ability to maintain SecF solubility and functionality:

    • Mild detergents (DDM, LDAO) at concentrations just above their CMC are typically effective

    • Detergent mixtures sometimes provide superior results to single detergents

    • Fluorinated detergents can improve stability for structural studies

  • Fusion partners: N-terminal fusion with solubility-enhancing tags (MBP, SUMO) in addition to the His-tag can improve expression and solubility.

  • Nanodiscs and amphipols: Reconstituting purified SecF into nanodiscs or transferring it to amphipols provides a more native-like membrane environment while maintaining aqueous solubility.

  • Co-expression strategies: Co-expressing SecF with its partner SecD can improve folding and stability of both proteins.

  • Buffer optimization: Including 6% trehalose and optimizing pH to 8.0 has been shown to significantly enhance SecF stability during storage and reconstitution .

What methodologies are most effective for studying SecF-mediated protein translocation in Prochlorococcus marinus?

For investigating the mechanism of SecF-mediated protein translocation in Prochlorococcus marinus, researchers should consider these specialized approaches:

  • Real-time translocation assays: Fluorescence-based assays using environmentally sensitive probes attached to substrate proteins can track translocation kinetics in real-time.

  • Single-molecule approaches: Techniques such as optical tweezers or magnetic tweezers can measure the forces involved in SecF-mediated protein movement across membranes.

  • Cryo-electron microscopy: This approach can capture different conformational states of SecF during the translocation cycle, particularly when used with translocation intermediates trapped using non-hydrolyzable ATP analogs or specific inhibitors.

  • In vivo secretion assays: Reporter proteins fused to Prochlorococcus-specific signal sequences can monitor translocation efficiency in heterologous expression systems.

  • Reconstituted system studies: In vitro systems containing purified SecYEG, SecDF-YajC, and SecA components can isolate the specific contribution of SecF to the translocation process.

These methods can provide insights into how SecF contributes to the unique secretory requirements of Prochlorococcus marinus, particularly in relation to the extracellular products that influence its ecological interactions .

How does SecF function relate to Transparent Exopolymer Particle (TEP) production in Prochlorococcus?

Recent research suggests a potential link between protein translocation systems and the production of Transparent Exopolymer Particles (TEPs) in Prochlorococcus marinus:

  • TEPs are polysaccharide-rich particles that contribute significantly to the marine carbon cycle, and Prochlorococcus has been identified as a potential source of these particles, particularly under high solar radiation conditions .

  • The secretion of exopolysaccharides and glycoproteins that contribute to TEP formation likely involves the Sec translocation pathway, including the SecF component.

  • Experimental evidence shows that Prochlorococcus marinus cultures produce significant amounts of TEP, particularly during stationary phase, reaching concentrations comparable to those produced by diatom cultures (approximately 1474 ± 226 μg XG Eq. L-1) .

  • The cellular processes linking protein translocation to TEP production may involve:

    • SecF-dependent export of glycosyltransferases and other enzymes involved in exopolysaccharide synthesis

    • Translocation of proteins that regulate cell surface properties affecting aggregation

    • Secretion of stress-response proteins during conditions that also trigger TEP production

Understanding the role of SecF in these processes could provide insights into both cellular physiology and the ecological contributions of Prochlorococcus to marine carbon cycling .

What techniques can be used to study the impact of environmental factors on SecF function in Prochlorococcus marinus?

To investigate how environmental factors influence SecF function in Prochlorococcus marinus, researchers can employ these methodological approaches:

  • Gene expression analysis: qRT-PCR or RNA-seq to quantify secF expression under varying conditions:

    • Different light intensities (including UV exposure)

    • Temperature gradients

    • Nutrient limitation scenarios

    • Co-culture with heterotrophic bacteria

  • Proteomics analysis: Quantitative proteomics to measure SecF protein abundance and post-translational modifications under environmental stress.

  • Translocation efficiency assays: Using reporter proteins to assess how environmental conditions affect the efficiency of SecF-dependent protein translocation.

  • On-deck incubation experiments: Similar to those described in the literature for TEP production studies, these can simulate natural conditions while allowing for controlled manipulation of environmental variables .

  • Flow cytometry monitoring: To correlate cell physiological states with secF expression and protein translocation activity under different conditions.

These approaches can help elucidate how this marine cyanobacterium adapts its protein translocation machinery to thrive in oligotrophic oceans, particularly in response to stressors like high solar radiation that affect Prochlorococcus more severely than other picocyanobacteria like Synechococcus .

What are the most promising future research directions for Prochlorococcus marinus SecF studies?

Several high-potential research avenues exist for advancing our understanding of Prochlorococcus marinus SecF:

  • Structural biology: Determining high-resolution structures of Prochlorococcus SecF alone and in complex with other Sec components could reveal adaptations specific to this marine organism.

  • Systems biology approaches: Integrating transcriptomic, proteomic, and metabolomic data to understand how SecF functions within the broader cellular network, particularly in response to environmental changes.

  • Comparative genomics: Analyzing SecF sequence and functional variations across different Prochlorococcus ecotypes and related marine cyanobacteria to identify evolutionary adaptations.

  • Climate change impacts: Investigating how predicted ocean warming and acidification might affect SecF function and consequently Prochlorococcus physiology and ecology.

  • Biotechnological applications: Exploring whether unique properties of Prochlorococcus SecF could be harnessed for improved heterologous protein expression or secretion systems.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.