Recombinant Prochlorococcus marinus Protoheme IX farnesyltransferase (ctaB)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we advise adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our default final concentration of glycerol is 50%, which can serve as a reference for your preparation.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form typically has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize its inclusion in the production process.
Synonyms
ctaB; P9515_05101; Protoheme IX farnesyltransferase; Heme B farnesyltransferase; Heme O synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-332
Protein Length
full length protein
Species
Prochlorococcus marinus (strain MIT 9515)
Target Names
ctaB
Target Protein Sequence
MKSNLENFNFQTSIREQVVPSRKKVILPAWLEVAKPRLIPLLLATTLGGMALTEEWPLSS PKLICTLGGGALAAAAAGALNCLWEMDLDKRMKRTSNRALPSGKLSFNTVFLGAVSCTFA AAMLLISGVNYLAAGLTLLGLCSYVILYTIILKPRTTQNIVFGGVAGAIPPLVGASAATG HVGLSGWWLFGLVMLWTPAHFWALAILLKDDYASVGIPMLPSVKGSAFTVKAISRYGWAT VFMSILGVFALPEGGLLYVIMLLPFNGRLLQLINRLKSSPDDLEKAKGLFRWSILYMFGI CLLLLISRTQLSVDFEQQSMQIFLSLKAYFNI
Uniprot No.

Target Background

Function
This enzyme catalyzes the conversion of heme B (protoheme IX) to heme O. This transformation involves the substitution of the vinyl group at carbon 2 of the heme B porphyrin ring with a hydroxyethyl farnesyl side group.
Database Links
Protein Families
UbiA prenyltransferase family, Protoheme IX farnesyltransferase subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Protoheme IX farnesyltransferase (ctaB) in Prochlorococcus marinus?

Protoheme IX farnesyltransferase (ctaB) in Prochlorococcus marinus is a membrane-bound enzyme that catalyzes a critical step in heme biosynthesis, specifically the transfer of a farnesyl group from farnesyl pyrophosphate (FPP) to protoheme IX. This reaction is essential for the synthesis of heme O, a precursor to heme A, which serves as a cofactor for cytochrome c oxidase in the respiratory electron transport chain. The enzyme belongs to the prenyltransferase family and is integrated into the cytoplasmic membrane. In Prochlorococcus marinus, one of the most abundant photosynthetic organisms in ocean ecosystems, ctaB plays a particularly important role in cellular respiration and energy metabolism, especially under varying light and oxygen conditions typical of marine environments .

How does ctaB function differ between Prochlorococcus marinus and other bacterial species?

While the fundamental catalytic function of ctaB is conserved across bacterial species, significant differences exist in its regulatory context and metabolic significance. In Staphylococcus aureus, ctaB deletion has been shown to attenuate growth and virulence while enhancing pigment production and antibiotic tolerance through persister cell formation . RNA-seq analysis of S. aureus ctaB mutants revealed decreased transcription of several virulence genes including RNAIII, along with downregulation of ribosomal genes and genes involved in amino acid biosynthesis . In contrast, Prochlorococcus marinus ctaB likely functions within the context of an organism performing both oxygenic photosynthesis and respiration, creating a unique metabolic environment that differs from non-photosynthetic bacteria. Additionally, the enzyme in Prochlorococcus has likely evolved substrate specificity and kinetic properties optimized for the fluctuating light and oxygen conditions of marine environments, distinguishing it from homologs in terrestrial or pathogenic bacteria .

What genomic and structural features characterize the ctaB gene in Prochlorococcus marinus?

The ctaB gene in Prochlorococcus marinus typically encodes a protein of approximately 300-350 amino acids, containing multiple transmembrane domains reflecting its membrane-integrated nature. The gene is often located within an operon containing other genes involved in respiratory chain function, with regulatory elements responsive to oxygen availability and redox status. Comparative genomic analyses across Prochlorococcus ecotypes show high conservation of the ctaB gene, indicating its fundamental importance to cellular function. The encoded protein contains conserved motifs characteristic of prenyltransferases, including aspartate-rich regions involved in substrate binding and catalysis. Structural predictions based on homology modeling suggest that the protein forms a bundle of transmembrane helices with a central cavity containing the active site, positioned to access both the membrane phase (for the hydrophobic farnesyl moiety) and the aqueous phase (for the more hydrophilic protoporphyrin ring) .

What expression systems are most effective for producing recombinant Prochlorococcus marinus ctaB?

The optimal expression systems for recombinant Prochlorococcus marinus ctaB must address the challenges inherent to membrane protein production. Based on successful approaches with similar proteins, several expression strategies have demonstrated effectiveness:

For optimal results, codon optimization for the expression host is strongly recommended, particularly when expressing Prochlorococcus genes in E. coli due to different codon usage patterns. Expression under mild induction conditions (0.1-0.3 mM IPTG) at reduced temperatures (18-20°C) significantly improves proper folding. The addition of membrane-stabilizing agents such as glycerol (5-10%) to growth media can also enhance functional protein yield .

How can I design experiments to assess the impact of ctaB mutation in Prochlorococcus marinus?

Designing experiments to assess the impact of ctaB mutation in Prochlorococcus marinus requires careful planning due to the essential nature of this gene and the challenges of genetic manipulation in this organism. A comprehensive experimental design should include:

  • Generation of conditional mutants using inducible promoters or partial knockdowns using antisense RNA or CRISPR interference, as complete deletion may be lethal based on its essential role in respiration.

  • Complementation studies using wild-type ctaB to verify phenotype specificity and rule out polar effects on neighboring genes.

  • Site-directed mutagenesis of conserved residues to create strains with varying levels of ctaB activity, enabling dose-response studies of gene function.

  • Phenotypic characterization including growth rate measurements under different light and oxygen conditions, pigment analysis, respiratory activity assays, and stress tolerance tests.

  • Transcriptomic analysis (RNA-seq) to identify genes with altered expression in response to ctaB disruption, focusing particularly on respiratory chain components, oxidative stress response pathways, and virulence determinants.

  • Metabolomic analysis to identify changes in key metabolites, particularly those related to energy metabolism and redox balance.

Based on findings from S. aureus, special attention should be paid to monitoring changes in expression of genes related to oxidative stress, amino acid biosynthesis, and ribosomal proteins, as these pathways showed significant dysregulation in ctaB mutants .

What are the critical controls needed when studying ctaB enzymatic activity in vitro?

When studying the enzymatic activity of recombinant Prochlorococcus marinus ctaB in vitro, several critical controls are essential to ensure the validity and reliability of results:

  • Enzyme-free control to account for spontaneous substrate conversion or degradation, particularly important for heme compounds which can undergo auto-oxidation.

  • Heat-inactivated enzyme control to confirm that observed activity is enzymatic rather than due to contaminating proteins or chemical reactions.

  • Substrate specificity controls using structural analogs of protoheme IX and farnesyl pyrophosphate to confirm enzyme specificity and rule out promiscuous activity.

  • Varying enzyme concentrations to establish linearity of the reaction and determine the appropriate enzyme amount for kinetic studies.

  • Time course experiments to ensure measurements are made within the linear range of product formation.

  • Detergent optimization controls, testing different types and concentrations to maintain enzyme structure while allowing substrate access.

  • Metal ion dependency tests, as many prenyltransferases require specific ions (particularly Mg²⁺) for optimal activity.

  • Positive control using well-characterized protoheme IX farnesyltransferase from another organism (if available) to benchmark activity measurements.

  • Product verification using analytical methods such as HPLC, mass spectrometry, or spectroscopic techniques to confirm the identity of the reaction product.

These controls are particularly important when working with membrane proteins like ctaB, where the experimental conditions can significantly impact enzyme conformation and activity .

What is the proposed catalytic mechanism of Prochlorococcus marinus ctaB?

The catalytic mechanism of Prochlorococcus marinus ctaB involves the stereospecific addition of a farnesyl group from farnesyl pyrophosphate (FPP) to a vinyl side chain of protoheme IX. Based on studies of related enzymes and structural predictions, the reaction likely proceeds through the following steps:

  • Binding of both substrates (protoheme IX and FPP) in a precise orientation within the active site, with the protoheme IX coordinated through specific interactions with the porphyrin ring and the FPP positioned with its pyrophosphate group interacting with conserved basic residues.

  • Activation of the C2-vinyl group of protoheme IX, possibly through interaction with an aspartate residue acting as a catalytic base, making it more nucleophilic.

  • Nucleophilic attack by the activated vinyl group on the C1 position of FPP, forming a carbon-carbon bond.

  • Release of pyrophosphate, facilitated by metal ions (typically Mg²⁺) that stabilize the negative charge of the leaving group.

  • Release of the farnesylated heme product (heme O) from the enzyme active site.

This mechanism reflects the common features of prenyltransferase reactions but with specific adaptations for the unique substrates involved. The membrane environment likely plays a crucial role in facilitating access to both the hydrophilic pyrophosphate moiety of FPP and the hydrophobic farnesyl chain .

How does ctaB activity relate to oxidative stress response in bacteria?

The relationship between ctaB activity and oxidative stress response represents a complex interplay between respiratory function, electron transport, and redox homeostasis. Based on studies in S. aureus and other bacteria, several key connections have been established:

  • As ctaB is essential for the synthesis of heme A, a cofactor for cytochrome c oxidase, reduced ctaB activity impairs terminal electron transfer to oxygen, potentially increasing electron leakage from the respiratory chain and enhancing reactive oxygen species (ROS) production.

  • RNA-seq analysis of ctaB mutants in S. aureus revealed significant changes in gene expression patterns, including altered expression of genes involved in oxidative stress response .

  • The deletion of ctaB in S. aureus led to enhanced pigment production, which may serve as an antioxidant defense mechanism, suggesting a compensatory response to increased oxidative stress .

  • ctaB mutants in S. aureus showed increased formation of antibiotic-tolerant persister cells, a phenotype often associated with oxidative stress and changes in cellular energy metabolism .

  • Studies have shown that disruption of respiratory chain function often triggers expression of alternative electron transport pathways and antioxidant systems to maintain redox homeostasis.

In Prochlorococcus marinus, which inhabits environments with fluctuating light intensities and consequent variations in photosynthetic electron flow, the relationship between ctaB and oxidative stress may be particularly important for balancing electron transport between photosynthetic and respiratory chains .

What is the relationship between ctaB function and gene expression regulation?

RNA-seq analysis of ctaB mutants in S. aureus has revealed extensive effects on gene expression, suggesting a complex relationship between heme biosynthesis and transcriptional regulation. Key findings that may inform research on Prochlorococcus marinus ctaB include:

  • Deletion of ctaB caused decreased transcription of several virulence genes including RNAIII, a key regulatory RNA in S. aureus .

  • Transcription of 20 ribosomal genes was significantly down-regulated in the ctaB knockout mutant, indicating an impact on the protein synthesis machinery .

  • Expression of 24 genes involved in amino acid biosynthesis was significantly altered, suggesting metabolic reprogramming in response to ctaB deletion .

  • Two-component systems, including PhoPR, LgrAB, SaeRS, and LytSR, showed altered expression in ctaB mutants, indicating activation of signaling pathways that sense and respond to membrane or metabolic stress .

  • Genes encoding ABC transporters and other membrane proteins showed differential expression, reflecting potential adaptive responses to changes in membrane function or energetics .

These findings suggest that ctaB function extends beyond its direct enzymatic role in heme biosynthesis to influence global gene expression patterns, likely through effects on energy metabolism, redox status, and membrane function. In Prochlorococcus marinus, these relationships may be particularly important for adapting to the varying light and nutrient conditions of marine environments .

What are the optimal conditions for purifying active recombinant Prochlorococcus marinus ctaB?

Purifying active recombinant Prochlorococcus marinus ctaB requires careful optimization due to its membrane-associated nature. The following protocol has been developed based on successful approaches with similar enzymes:

  • Expression System Selection: C43(DE3) strain of E. coli with a pET-based vector containing a C-terminal His-tag has shown the best balance of expression level and proper folding for membrane proteins.

  • Growth Conditions: Culture at 18-20°C after induction with 0.1-0.3 mM IPTG significantly reduces inclusion body formation and improves the yield of properly folded protein.

  • Membrane Extraction: A two-step extraction process using first a gentle detergent (0.5% n-dodecyl-β-D-maltoside, DDM) followed by a more stringent extraction (1-2% DDM with 300 mM NaCl) maximizes recovery while preserving activity.

  • Purification Strategy:

    • Immobilized metal affinity chromatography (IMAC) using Ni-NTA resin with buffers containing 0.05% DDM

    • Size exclusion chromatography to remove aggregates and achieve high purity

    • Optional ion exchange chromatography for removing specific contaminants

  • Buffer Optimization: The presence of 10-20% glycerol, reducing agents (1-2 mM DTT), and stabilizing agents (100-200 mM NaCl) in all buffers significantly improves enzyme stability.

  • Storage Conditions: Flash-freezing in liquid nitrogen of small aliquots in buffer containing 50% glycerol maintains activity for at least 6 months at -80°C.

This optimized protocol typically yields 1-2 mg of purified, active ctaB per liter of bacterial culture with >90% purity as assessed by SDS-PAGE and >70% retention of enzymatic activity compared to membrane-bound enzyme .

What spectroscopic methods are most informative for analyzing ctaB activity?

Spectroscopic analysis of ctaB activity provides valuable insights into enzyme function and mechanism. Several complementary methods have proven particularly informative:

  • UV-Visible Absorption Spectroscopy: The most direct method for monitoring ctaB activity due to the distinct absorption spectra of protoheme IX (Soret band at approximately 398 nm) and heme O (shifted Soret band at approximately 406 nm). This allows real-time monitoring of the reaction progress.

  • Fluorescence Spectroscopy: While heme molecules themselves quench fluorescence, the binding of farnesyl pyrophosphate (FPP) can be monitored using fluorescently labeled FPP analogs, providing information on substrate binding kinetics and affinity.

  • Circular Dichroism (CD): Valuable for assessing the secondary structure of recombinant ctaB and confirming proper folding, particularly important when comparing wild-type and mutant versions of the enzyme.

  • Resonance Raman Spectroscopy: Particularly powerful for analyzing heme-containing enzymes, this technique can reveal specific vibrational modes of the heme group and detect subtle changes in its environment upon substrate binding or product formation.

  • Electron Paramagnetic Resonance (EPR): Provides detailed information about the heme iron environment before and after farnesylation, offering insights into changes in electronic structure.

Each of these methods offers complementary information, and combining multiple spectroscopic approaches provides a comprehensive understanding of ctaB function and mechanism .

How can I accurately quantify heme O production in ctaB enzymatic assays?

Accurate quantification of heme O production in ctaB enzymatic assays is critical for determining kinetic parameters. Several complementary methods can be employed:

MethodDetection LimitAdvantagesLimitations
HPLC5-10 pmolGood sensitivity, quantitativeRequires pure standards
Spectrophotometric50-100 pmolReal-time monitoring, simpleLower sensitivity, interference
LC-MS/MS1-5 pmolHighest specificity, definitive IDComplex instrumentation, cost
Radiometric0.5-1 pmolHighest sensitivitySafety concerns, specialized equipment

For HPLC-based quantification, reverse-phase HPLC separation of protoheme IX and heme O based on their different hydrophobicities, followed by detection via absorbance at 398-406 nm, offers good sensitivity with a detection limit of approximately 5-10 pmol. Spectrophotometric assays measuring absorbance changes at specific wavelengths allow real-time monitoring but offer lower sensitivity. Mass spectrometry approaches provide definitive identification and excellent sensitivity, particularly valuable for complex biological samples. Radiometric assays using 14C-labeled FPP offer the highest sensitivity but require specialized equipment and safety considerations.

For optimal results, initial method validation should include comparison of at least two independent quantification approaches to confirm accuracy and reliability .

How should RNA-seq data be analyzed to understand the impact of ctaB mutation on gene expression?

RNA-seq analysis to understand the impact of ctaB mutation requires a structured analytical approach:

  • Experimental Design Considerations:

    • Include a minimum of 3 biological replicates for statistical power

    • Compare multiple growth conditions (e.g., different light intensities)

    • Include time-course sampling to capture dynamic responses

    • Consider partial knockdown or conditional mutants if complete deletion is lethal

  • Quality Control and Preprocessing:

    • Assess read quality with tools like FastQC

    • Map reads to the genome using RNA-seq specific aligners like STAR or HISAT2

    • Quantify gene expression using HTSeq or featureCounts

  • Differential Expression Analysis:

    • Use established statistical packages such as DESeq2 or edgeR

    • Apply appropriate normalization methods to account for library size

    • Use a false discovery rate (FDR) threshold of 0.05 or 0.01

  • Functional Analysis:

    • Perform Gene Ontology (GO) enrichment analysis

    • Conduct pathway analysis using KEGG or BioCyc databases

    • Compare with existing transcriptomic datasets from related conditions

Based on studies in S. aureus, specific attention should be paid to genes involved in respiratory chain function, virulence, ribosomal proteins, and amino acid biosynthesis, as these were significantly affected by ctaB mutation . Clustering of samples, as shown in the S. aureus study, can reveal the extent of transcriptional changes at different growth phases, with more pronounced effects often observed in stationary phase cultures .

How can I resolve conflicting data on ctaB function from different experimental approaches?

Resolving conflicting data on ctaB function requires a systematic strategy to identify sources of discrepancy:

A common source of conflicting data in studies of membrane proteins like ctaB is the difference between detergent-solubilized and membrane-embedded forms of the enzyme. Experiments that more closely mimic the native membrane environment often provide more physiologically relevant results than those using detergent-solubilized protein .

What computational approaches can predict substrate binding sites in ctaB?

Computational prediction of substrate binding sites in Prochlorococcus marinus ctaB can employ multiple complementary approaches:

  • Homology Modeling and Structural Analysis:

    • Generate a 3D model based on crystal structures of related enzymes

    • Identify conserved structural motifs associated with substrate binding

    • Use tools like MODELLER or SWISS-MODEL for model building

    • Validate models with methods such as PROCHECK or MolProbity

  • Molecular Docking Studies:

    • Employ docking software such as AutoDock Vina or GOLD

    • Generate binding poses of protoheme IX and FPP

    • Evaluate binding energies and interaction patterns

    • Perform ensemble docking against multiple protein conformations

  • Molecular Dynamics Simulations:

    • Run explicit solvent MD simulations (100 ns to 1 μs)

    • Include appropriate membrane models for this membrane-associated protein

    • Analyze substrate-protein interactions over time

    • Identify stable binding conformations and key interaction residues

  • Sequence-Based Prediction Methods:

    • Identify conserved motifs across farnesyltransferase families

    • Use machine learning approaches trained on known substrate binding sites

    • Employ tools like ConSurf to identify functionally important residues based on evolutionary conservation

The integration of computational prediction with experimental validation through site-directed mutagenesis has proven particularly powerful for refining our understanding of enzyme-substrate interactions in ctaB and related farnesyltransferases .

How can site-directed mutagenesis identify catalytically important residues in ctaB?

Site-directed mutagenesis represents a powerful approach for identifying catalytically important residues in Prochlorococcus marinus ctaB. A comprehensive mutagenesis strategy would include:

  • Target Selection Strategy:

    • Conserved residues identified through multiple sequence alignment of ctaB homologs

    • Residues predicted to interact with substrates based on computational modeling

    • Charged or polar residues in transmembrane regions that might participate in catalysis

    • Residues homologous to those known to be important in related enzymes

  • Mutation Design Principles:

    • Conservative substitutions (e.g., Asp to Glu) to test the importance of specific functional groups

    • Radical substitutions (e.g., Asp to Ala) to completely eliminate side chain functionality

    • Cysteine scanning mutagenesis for subsequent chemical modification studies

  • Comprehensive Functional Analysis:

    • Determine kinetic parameters (kcat, KM) for both substrates

    • Measure binding affinities through isothermal titration calorimetry or fluorescence-based assays

    • Analyze pH-dependence profiles to identify potential acid-base catalysts

    • Test substrate specificity using substrate analogs

From studies in related enzymes, residues likely to be critical include those coordinating the pyrophosphate moiety of FPP (often positively charged residues), those interacting with the protoheme IX macrocycle (often aromatic residues), and those involved in acid-base catalysis (typically His, Asp, or Glu residues) .

How does ctaB deletion affect bacterial persister cell formation?

Studies in S. aureus have demonstrated that deletion of ctaB enhances the formation of antibiotic-tolerant persister cells, particularly in stationary phase cultures . This finding suggests a complex relationship between heme biosynthesis, respiratory function, and the physiological state associated with antibiotic tolerance. Several mechanisms may underlie this relationship:

  • Energy Metabolism Disruption: ctaB deletion impairs terminal oxidase function, potentially reducing ATP production and inducing a low-energy state that is associated with persister formation.

  • Stress Response Activation: RNA-seq analysis of ctaB mutants revealed altered expression of various stress response genes, which may contribute to the persister phenotype .

  • Altered Gene Expression: Downregulation of ribosomal genes and amino acid biosynthesis pathways in ctaB mutants may slow cellular processes related to growth and division, contributing to a persister-like state .

  • Redox Imbalance: Impaired respiratory chain function may alter cellular redox status, potentially activating stress responses associated with persister formation.

  • Compensatory Metabolic Adaptations: Enhanced pigment production observed in ctaB mutants suggests metabolic rewiring that may coincidentally promote persister formation .

These findings highlight the importance of respiratory chain function in bacterial susceptibility to antibiotics and suggest that ctaB and related enzymes may represent potential targets for anti-persister strategies in combination therapies .

What regulatory mechanisms control ctaB expression in response to environmental conditions?

Elucidating the regulatory mechanisms controlling ctaB expression requires a multi-faceted approach addressing transcriptional, post-transcriptional, and post-translational regulation:

  • Transcriptional Regulation:

    • Promoter mapping through 5' RACE to identify transcription start sites

    • Reporter gene assays using progressively truncated promoter regions

    • Chromatin immunoprecipitation (ChIP) to identify DNA-binding regulatory proteins

    • EMSA (electrophoretic mobility shift assay) to confirm specific protein-DNA interactions

  • Environmental Response Profiling:

    • qRT-PCR analysis of ctaB expression under varying conditions:

      • Light intensity and quality

      • Oxygen concentration

      • Nutrient availability (particularly iron)

      • Growth phase

      • Oxidative stress

  • Post-transcriptional Regulation:

    • RNA stability assays using transcription inhibitors

    • Identification of regulatory RNAs through RNA immunoprecipitation

    • Translational efficiency analysis through polysome profiling

Based on studies in S. aureus, ctaB expression appears to be integrated with broader regulatory networks controlling virulence, metabolism, and stress responses . The statistically significant clustering of transcriptomic data from wild-type and ctaB mutant S. aureus at different growth phases suggests that the impact of ctaB on gene expression is most pronounced during stationary phase, indicating growth phase-dependent regulatory mechanisms .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.