Recombinant Prochlorococcus marinus Proton extrusion protein PcxA (pcxA)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant PcxA

Recombinant PcxA is a full-length, His-tagged protein expressed in Escherichia coli for research applications . Derived from Prochlorococcus marinus, a dominant marine cyanobacterium contributing ~20% of global oceanic photosynthesis , PcxA plays roles in proton extrusion and cellular ion homeostasis. Its recombinant form enables biochemical studies under controlled conditions.

Primary Structure

  • Amino Acid Sequence: The protein comprises 461 residues (UniProt ID: P59112) . A truncated variant (1-376 aa, UniProt ID: A2C9Q5) is also available .

  • Domains: Predicted transmembrane helices suggest ion channel functionality, though exact topology remains uncharacterized.

Post-Translational Modifications

  • Carbamidomethylation and oxidation modifications are observed in proteomic studies .

Functional Roles in Prochlorococcus marinus

  • Proton Extrusion: PcxA facilitates proton transport across membranes, critical for maintaining pH gradients during photosynthesis .

  • Nitrogen Metabolism: Under nitrogen limitation, Prochlorococcus remodels its proteome, though PcxA’s direct involvement requires further study .

  • Environmental Adaptation: Genetic diversity in pcxA across ecotypes (e.g., high-light vs. low-light adapted strains) may reflect niche-specific optimization .

Research Use

  • Expression System: Produced in E. coli with >90% purity .

  • Storage: Lyophilized powder stable at -80°C; reconstitution in Tris/PBS buffer with 6% trehalose preserves activity .

Key Research Findings

  • Proteomic Profiling: Nitrogen limitation induces proteome remodeling in Prochlorococcus, though PcxA expression levels show minimal variation .

  • Thermostability: Retains activity after repeated freeze-thaw cycles when stored with glycerol .

  • Ecotypic Variation: Genomic analyses reveal pcxA homologs in Synechococcus, suggesting evolutionary conservation of proton extrusion mechanisms .

Comparative Genomics

FeatureProchlorococcus marinus SS120 Synechococcus WH 7805
Genomic G+C Content36.82%47–69.5%
Nitrogen UtilizationLimited transporters Broad substrate range
pcxA Homology90% sequence similarity70–80% similarity

Future Directions

  • Mechanistic Studies: Elucidate PcxA’s role in photoprotection and carbon fixation.

  • Ecological Impact: Link pcxA expression to Prochlorococcus’s dominance in oligotrophic oceans .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate your requirement during order placement, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: Our proteins are standardly shipped with normal blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life for liquid form is 6 months at -20°C/-80°C. The shelf life for lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt; aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
pcxA; PMT_0748; Proton extrusion protein PcxA
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-382
Protein Length
full length protein
Species
Prochlorococcus marinus (strain MIT 9313)
Target Names
pcxA
Target Protein Sequence
MTLRDWMRTFGEARSIDINNDLERGYEAALLIQTLELEYYGDRPIRPNLQLSVPRSLQST ILRKFHTAANICRLTFEAIKPNVSQLDSQEYRKYQLIETIVNRYAPKRSSRSTSISRAPD ALPRSLLGLVDKVRRQLDPTSEATLVAGFRRRRDSTLISLKIILLLILVPLLVQQISRTY LITPAIDYLAPELPFLSYPKPQLEEQAVEKLRVFKAEIEFDALLKGDSIPSQDELQKALA IKAIQLKDEADKESTHAIKNVLADLAALIAFAFVCIINREELRVLRGFLDEAIYGLSDSA KAFAIILFTDMFVGFHSPEGWQVLLQGIANHFGFPARENFILLFIATFPVILATIFKYWI FRYLNRVSPSSVATLRGMNGSS
Uniprot No.

Target Background

Function
PcxA is involved in light-induced Na(+)-dependent proton extrusion. It also appears to play a role in CO(2) transport.
Database Links

KEGG: pmt:PMT_0748

STRING: 74547.PMT0748

Protein Families
Cema family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Prochlorococcus marinus and why is it significant for PcxA protein research?

Prochlorococcus marinus is a minute photosynthetic prokaryote with exceptional ecological significance. With a diameter of just 0.5 to 0.7 μm, it holds the distinction of being the smallest known photosynthetic organism on Earth . The significance of this organism extends beyond its size - Prochlorococcus is ubiquitous throughout oceanic regions between 40°S and 40°N latitudes, where it dominates the photosynthetic biomass in oligotrophic (nutrient-poor) waters . Its abundance makes it presumably the most numerous photosynthetic organism on our planet, with populations extending from the surface to depths of approximately 200 meters .

The evolutionary trajectory of Prochlorococcus involved genome reduction and adaptation to nutrient-limited environments, making it an excellent model for studying specialized proteins like PcxA that may play crucial roles in its metabolic efficiency . The organism typically undergoes one division daily in the subsurface layer of oligotrophic areas, demonstrating remarkable productivity despite resource limitations . PcxA research is particularly valuable because proton extrusion mechanisms are fundamental to energy generation in photosynthetic organisms, potentially providing insights into how Prochlorococcus achieves metabolic efficiency in challenging environments.

What is the structural basis of PcxA function in Prochlorococcus marinus?

The PcxA protein in Prochlorococcus marinus functions as a proton extrusion protein, likely involved in maintaining cellular pH homeostasis and potentially contributing to energy transduction processes. While specific structural information on PcxA is limited, analysis of other Prochlorococcus membrane proteins provides contextual understanding of how PcxA might function.

Prochlorococcus has evolved specialized protein structures to maximize efficiency in low-nutrient environments. For instance, the photosystem I (PSI) complexes in Prochlorococcus contain modified PsaL and PsaI proteins that form complexes involved in the stabilization of PSI trimers . The PsaL protein in Prochlorococcus features an anomalous length compared to other cyanobacteria, yet maintains its functional role in photosystem organization . By analogy, the PcxA protein likely exhibits structural adaptations that optimize its function within the constraints of Prochlorococcus' reduced genome and specialized metabolism.

For experimental work with recombinant PcxA, researchers should note that commercially available recombinant PcxA is typically produced in E. coli expression systems and supplied in liquid form containing glycerol for stability . This preparation method helps maintain protein integrity during storage and experimental manipulation.

How does PcxA contribute to Prochlorococcus ecology and adaptation?

Prochlorococcus marinus exhibits remarkable ecological adaptation across various ocean environments, with genetically distinct ecotypes possessing different antenna systems and physiological characteristics adapted to specific depths in the water column . As a proton extrusion protein, PcxA likely plays a critical role in this adaptation process through several potential mechanisms:

  • pH regulation: By extruding protons, PcxA helps maintain optimal internal pH for cellular processes despite environmental variations.

  • Energy coupling: Proton extrusion creates electrochemical gradients that can be harnessed for energy-requiring processes, potentially enhancing metabolic efficiency in nutrient-limited environments.

  • Stress response: PcxA may contribute to Prochlorococcus' ability to respond to environmental stressors such as high light intensity or nutrient limitation.

The presence of distinct Prochlorococcus ecotypes at different depths suggests that proteins like PcxA may have adapted to function optimally under specific light and nutrient conditions . Surface ecotypes experience higher light intensities and potentially greater pH fluctuations than deep-water ecotypes, possibly leading to functional variations in PcxA across these populations.

What experimental approaches are optimal for studying recombinant PcxA protein expression and function?

When investigating the recombinant Prochlorococcus marinus Proton extrusion protein PcxA, researchers should consider several experimental approaches:

  • Codon optimization for E. coli expression

  • Testing multiple fusion tags (His, GST, MBP) to improve solubility

  • Evaluating low-temperature induction to enhance proper folding

  • Using specialized E. coli strains designed for membrane protein expression

Functional Characterization Methods:
For proton extrusion proteins, functional analysis often requires measurement of proton transport activity. Recommended approaches include:

MethodApplicationAdvantagesLimitations
pH-sensitive fluorescent probesReal-time monitoring of proton fluxNon-invasive, high temporal resolutionPotential interference from other cellular components
Liposome reconstitutionIsolated system for transport studiesControlled environment, quantitativeTechnical complexity, may not reflect in vivo conditions
Patch-clamp electrophysiologyDirect measurement of ion currentsPrecise quantification, real-timeTechnically demanding, requires specialized equipment
Isotope labelingTracking proton movementHigh sensitivityExpensive, safety considerations

For structural studies, researchers should consider X-ray crystallography, cryo-electron microscopy, or computational modeling approaches. Principal Component Analysis (PCA) can be valuable for analyzing complex datasets generated from these experiments .

How does PcxA integrate with photosynthetic electron transport in Prochlorococcus?

The integration of PcxA with photosynthetic electron transport in Prochlorococcus likely represents a specialized adaptation related to the organism's unique photosynthetic apparatus. Prochlorococcus contains distinctive pigment complements, including divinyl derivatives of chlorophyll a and b (Chl a2 and Chl b2), and some strains possess novel phycoerythrin variants . These modifications suggest a highly tuned photosynthetic system that may interface with PcxA in specialized ways.

Prochlorococcus photosystems exhibit several notable adaptations. For instance, the Photosystem I (PSI) in Prochlorococcus forms trimers stabilized by PsaL-PsaI complexes, despite the anomalous length of the PsaL protein . Additionally, Prochlorococcus strains SS120 and MED4 contain only a single copy of the psbA gene encoding the D1 protein of Photosystem II (PSII), unlike other cyanobacteria that typically possess multiple isoforms regulated differentially by light .

The proton extrusion function of PcxA may be coordinated with these photosystems to:

  • Maintain optimal pH gradients across thylakoid membranes for ATP synthesis

  • Regulate electron flow between photosystems under varying light conditions

  • Contribute to photoprotection mechanisms under high light stress

  • Facilitate adaptation to the specific light environments at different ocean depths

Research employing differential gene expression analysis and protein-protein interaction studies would be valuable for elucidating these potential relationships between PcxA and photosynthetic components.

How can systems biology approaches enhance our understanding of PcxA's role in Prochlorococcus metabolism?

Systems biology offers powerful frameworks for understanding PcxA's role within the broader metabolic network of Prochlorococcus marinus. As a proton extrusion protein, PcxA likely interfaces with multiple cellular systems, including photosynthesis, pH homeostasis, and energy transduction. Comprehensive understanding requires integration of multiple data types and modeling approaches.

Multi-omics Integration Strategy for PcxA Research:

  • Genomic analysis: Compare pcxA gene sequences across Prochlorococcus ecotypes to identify evolutionary patterns and potential functional variants.

  • Transcriptomics: Analyze pcxA expression under different environmental conditions (light intensity, nutrient availability, pH) to understand regulatory mechanisms.

  • Proteomics: Identify protein-protein interactions involving PcxA to map its functional network within the cell.

  • Metabolomics: Measure metabolic changes in PcxA mutants or under different expression levels to assess metabolic impact.

  • Flux analysis: Quantify changes in proton flux and energy parameters related to PcxA activity.

Computational Modeling Approaches:

Modeling ApproachApplication to PcxA ResearchData Requirements
Genome-scale metabolic modelsPredict metabolic consequences of PcxA perturbationGenome annotation, metabolic reaction stoichiometry
Protein structure predictionElucidate PcxA functional mechanismsAmino acid sequence, homologous structures
Ecological modelsUnderstand PcxA contribution to fitness across environmentsExpression data, growth rates, environmental parameters
Systems-level simulationsIntegrate PcxA function with cellular processesMulti-omics data, kinetic parameters

These systems approaches can help resolve how a seemingly specialized function (proton extrusion) contributes to the remarkable ecological success of Prochlorococcus in oligotrophic marine environments.

What are the optimal protocols for recombinant expression and purification of Prochlorococcus PcxA?

Successful recombinant expression and purification of Prochlorococcus marinus PcxA requires careful optimization due to the challenges often associated with membrane proteins. Below is a recommended protocol framework based on established practices for similar proteins:

Expression Protocol:

  • Vector Selection: pET-based expression vectors with T7 promoter systems offer strong, inducible expression for PcxA. Include a C-terminal His-tag for purification.

  • Host Strain: E. coli BL21(DE3) serves as the standard expression host , though specialized strains like C41(DE3) or C43(DE3) may improve membrane protein yields.

  • Culture Conditions:

    • Initial growth at 37°C to OD600 of 0.6-0.8

    • Induction with 0.1-0.5 mM IPTG

    • Post-induction temperature reduction to 16-18°C for 16-20 hours

    • Supplementation with 5% glycerol to stabilize membrane proteins

Purification Strategy:

  • Cell Lysis: Gentle disruption using sonication or pressure-based methods in buffer containing:

    • 50 mM Tris-HCl pH 8.0

    • 150 mM NaCl

    • 10% glycerol

    • Protease inhibitor cocktail

  • Membrane Fraction Isolation:

    • Low-speed centrifugation (10,000×g, 20 min) to remove cellular debris

    • Ultracentrifugation (100,000×g, 1 hour) to collect membrane fraction

  • Solubilization:

    • Resuspend membrane fraction in solubilization buffer containing:

      • 50 mM Tris-HCl pH 8.0

      • 150 mM NaCl

      • 10% glycerol

      • 1% n-Dodecyl β-D-maltoside (DDM) or 1% n-octyl-β-D-glucopyranoside (OG)

    • Gentle stirring for 2 hours at 4°C

  • Affinity Chromatography:

    • Load solubilized fraction onto Ni-NTA column

    • Wash with buffer containing 20-40 mM imidazole

    • Elute with 250 mM imidazole

    • Store purified protein in buffer containing 10% glycerol at -20°C or -80°C for extended storage

Quality Control:
For functional studies, verify protein integrity using:

  • SDS-PAGE for purity assessment

  • Western blotting for identity confirmation

  • Circular dichroism for secondary structure analysis

  • Size exclusion chromatography for oligomeric state determination

These methodological considerations should be adapted based on specific research objectives and the particular characteristics of the PcxA protein being studied.

How can researchers effectively apply principal component analysis to PcxA functional studies?

Principal Component Analysis (PCA) provides a powerful analytical framework for exploring complex datasets generated during PcxA functional studies. Particularly valuable for transcriptomic and proteomic experiments, PCA helps identify patterns of variation that may not be apparent through conventional analysis .

PCA Implementation for PcxA Research:

By effectively applying PCA to PcxA functional data, researchers can identify patterns of co-variation among experimental variables, detect outliers, visualize relationships between experimental conditions, and generate hypotheses about underlying biological mechanisms.

What comparative genomic approaches can reveal PcxA evolution in Prochlorococcus ecotypes?

Comparative genomic analysis offers valuable insights into the evolutionary history and functional diversification of PcxA across Prochlorococcus ecotypes. Given that Prochlorococcus has evolved by reducing cell and genome size from an ancestral cyanobacterium , tracking PcxA evolution provides a window into adaptation processes in this globally important organism.

Recommended Comparative Genomic Approaches:

  • Sequence-Based Analysis:

    • Multiple sequence alignment of pcxA genes from diverse Prochlorococcus ecotypes

    • Phylogenetic tree construction to visualize evolutionary relationships

    • Calculation of dN/dS ratios to identify signals of positive or purifying selection

    • Identification of conserved domains and variable regions

  • Genomic Context Analysis:

    • Examination of gene neighborhoods surrounding pcxA

    • Identification of potential operonic structures and co-regulated genes

    • Detection of horizontal gene transfer events through GC content analysis and phylogenetic incongruence

  • Ecotype-Specific Patterns:
    Different Prochlorococcus ecotypes are adapted to specific ocean depths and environmental conditions . Compare pcxA sequences and expression patterns across:

    • High-light adapted surface ecotypes

    • Low-light adapted deep-water ecotypes

    • Geographically distinct populations

  • Structural Prediction Comparisons:
    Use homology modeling to predict structural differences in PcxA proteins across ecotypes, particularly focusing on regions involved in:

    • Membrane integration

    • Proton binding and transport

    • Protein-protein interactions

    • Regulatory domains

The evolutionary trajectory of Prochlorococcus has been shaped by environmental constraints, particularly adaptation to nutrient-limited environments . By applying these comparative genomic approaches to PcxA, researchers can gain insights into how this specific protein has contributed to the ecological success of different Prochlorococcus lineages across diverse marine environments.

What are the most promising future research directions for PcxA in Prochlorococcus?

The study of Prochlorococcus marinus Proton extrusion protein PcxA presents several promising research avenues that could significantly advance our understanding of marine microbial physiology and ecology. As a central component in cellular energy transduction and pH homeostasis, PcxA likely plays critical roles in the remarkable environmental adaptation and ecological success of Prochlorococcus.

Priority Research Directions:

These research directions would benefit from interdisciplinary approaches combining molecular biology, biophysics, oceanography, and computational biology. Given the global significance of Prochlorococcus in marine primary production and carbon cycling, advances in understanding PcxA function could have broad implications for marine ecology and biogeochemistry.

How might PcxA research contribute to broader understanding of marine microbial adaptation?

Research on Prochlorococcus marinus PcxA extends beyond a single protein to inform our broader understanding of microbial adaptation in marine ecosystems. As the most abundant photosynthetic organism on Earth, inhabiting vast oceanic regions between 40°S and 40°N latitudes , Prochlorococcus represents a model system for studying how microorganisms optimize cellular functions under resource limitation.

PcxA research contributes to several fundamental questions in marine microbiology:

  • Genome Streamlining: Prochlorococcus evolution involved genome reduction and cell size minimization . Understanding how essential functions like proton extrusion are maintained or modified during this process provides insights into the minimal genetic requirements for photosynthetic life in oligotrophic environments.

  • Niche Differentiation: The existence of genetically distinct Prochlorococcus ecotypes with different light adaptation characteristics raises questions about how proteins like PcxA may have diversified to support specific ecological niches.

  • Metabolic Efficiency: The dominance of Prochlorococcus in nutrient-poor waters suggests exceptional metabolic efficiency. PcxA's role in energy transduction may be central to this efficiency, providing lessons for understanding microbial success under resource limitation.

  • Evolutionary Plasticity: Comparing PcxA across Prochlorococcus strains and related cyanobacteria can reveal how quickly and through what mechanisms proton transport systems can evolve in response to environmental pressures.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.