Recombinant Prochlorococcus marinus PsbF-like protein (PMT9312_1176)

Shipped with Ice Packs
In Stock

Description

Functional Insights

PMT9312_1176 belongs to the PsbF family, which in cyanobacteria is associated with photosystem II (PSII). While its exact role remains under investigation, functional analogs in PSII include:

Role in Photosynthesis

  • PSII Core Complex: PsbF proteins are β-subunits of cytochrome b559, stabilizing the PSII reaction center during light-driven water oxidation .

  • Electron Transfer: Belongs to the PsbE/PsbF family, which facilitates proton gradient formation by protecting the reaction center from oxidative damage .

Interacting ProteinsFunction in PSIIInteraction Score
PsbEα-subunit of cytochrome b5590.999
PsbD (D2)Reaction center heterodimer0.998
PsbA (D1)Primary electron donor binding site0.997

PMT9312_1176’s sequence divergence from canonical PsbF (e.g., in Prochlorococcus strain MIT9301) suggests strain-specific functional adaptations .

Genomic Context and Evolution

PMT9312_1176 is encoded by the PMT9312_1176 gene in the streamlined genome of P. marinus MIT9312, a high-light-adapted strain. Key genomic insights include:

  • Gene Amplification: Unlike freshwater cyanobacteria, P. marinus MIT9312 retains a single psbF-like gene, reflecting genomic reductionism .

  • Strain-Specific Expression: MIT9312 vesicles lack PMT9312_1176, unlike other vesicle-associated proteins (e.g., PMT9312_0858, 1179) .

Applications in Research

This recombinant protein is utilized in:

Immunological Studies

  • ELISA Kits: PMT9312_1176 serves as an antigen for detecting specific antibodies, enabling studies on cyanobacterial protein interactions .

  • Biochemical Assays: Purified protein is used to investigate PSII assembly, stability, or ligand binding .

Research Gaps and Future Directions

  • Functional Specificity: Direct biochemical assays are needed to confirm PMT9312_1176’s role in PSII versus other processes.

  • Interactome Mapping: Partners in DNA repair (e.g., LigW operon proteins) remain unexplored .

References

  1. Creative BioMart. Recombinant Full Length Prochlorococcus Marinus Psbf-Like Protein (PMT9312_1176).

  2. PMC. Prochlorococcus Extracellular Vesicles: Molecular Composition and Functional Specificity.

  3. Afigen. ELISA Recombinant Prochlorococcus marinus PsbF-like Protein.

  4. Research Commons. DNA Repair Enzymes in Prochlorococcus marinus Strain MIT9312.

  5. STRING-DB. PsbF Protein (Prochlorococcus marinus MIT9301).

  6. PMC. Genome Sequence of the Cyanobacterium Prochlorococcus marinus Strain SS120.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please specify them when placing your order. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please contact your local distributor for specific delivery times.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate with us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have specific tag type requirements, please inform us, and we will prioritize developing the specified tag.
Synonyms
PMT9312_1176; PsbF-like protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-98
Protein Length
full length protein
Species
Prochlorococcus marinus (strain MIT 9312)
Target Names
PMT9312_1176
Target Protein Sequence
MDFRVLLVISPIIFAWIFTVFWLGKWDVFRLTPFGLPKRGVAPFENYQVWGDSAVVPNTG RPSEGYPVFTVRTAAVNALGIPTVFFLGAILAMQFKSY
Uniprot No.

Target Background

Function
The function of this protein is currently unknown. It exhibits similarities to PsbF, a subunit of the photosystem II reaction center. However, it encodes asparagine instead of histidine at the site where PsbF binds heme.
Database Links
Protein Families
PsbE/PsbF family
Subcellular Location
Membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.