Recombinant Prochlorococcus marinus subsp. pastoris Apocytochrome f (petA)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Prochlorococcus marinus subsp. pastoris Apocytochrome f (petA)

Prochlorococcus marinus subsp. pastoris Apocytochrome f (petA) is a protein component of the cytochrome b6-f complex found in the marine cyanobacterium Prochlorococcus marinus subsp. pastoris . This cyanobacterium is notable for its small genome and its role as a primary producer in oligotrophic ocean environments . Apocytochrome f (petA) is a subunit of the cytochrome b6-f complex, which is essential for photosynthetic electron transport .

Characteristics of Prochlorococcus marinus subsp. pastoris

Prochlorococcus marinus is a marine cyanobacterium first described in 1992, notable for utilizing divinyl-chlorophyll a and b . Prochlorococcus marinus subsp. pastoris strain PCC 9511 is an axenic strain derived from the same primary culture as the type species . It is distinguished by horseshoe-shaped thylakoids, low chlorophyll b2 content, and the absence of phycoerythrin . The subspecies pastoris has a low mean DNA base composition (32 mol% G+C) and a small genome of approximately 2 Mbp . It favors urea and ammonia as nitrogen sources and can utilize various organic phosphorus compounds, indicating ecto-phosphohydrolase activity .

Recombinant Production of Apocytochrome f (petA)

Recombinant Apocytochrome f (petA) is produced using genetic engineering techniques, often in Escherichia coli, to obtain purified protein for research purposes . The recombinant protein typically includes a His-tag for simplified purification using affinity chromatography .

Table 1: Characteristics of Recombinant Prochlorococcus marinus subsp. pastoris Apocytochrome f (petA)

CharacteristicDescription
SourceE. coli
TagHis-tag (N-terminal)
Protein LengthFull Length of Mature Protein (35-317 amino acids)
FormLyophilized powder
PurityGreater than 90% as determined by SDS-PAGE
StorageStore at -20°C/-80°C upon receipt, avoid repeated freeze-thaw cycles
Storage BufferTris/PBS-based buffer, 6% Trehalose, pH 8.0
ReconstitutionReconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL; add 5-50% glycerol for long-term storage at -20℃/-80℃
Gene NamepetA
SynonymspetA; PMM0461; Cytochrome f
UniProt IDQ7V2L5
Amino Acid SequenceYPFWAQQNYESPREATGKIVCANCHLAQMPTIAEVPQSVGADSVFKAVVKIPYKDDIKEIGADGSAVPLQVGAVVMLPDGFKLAPQERWTDEIKEETEGVYFTNYSEEKDNIILVGPLPGDTNKEIVFPVLSPNPATNKEYHYGKYSLHIGGNRGRGQVYPTGEKSNNVIFTSSSAGTINS IETIEDGSYQINIENENGDIVTEAVPVGPKLIVKEQDQISAGDPLTNDPNVGGFGQLDAEVVLQSPYRIIGLIAFFIGVGLTQILLVLKKKQVEKVQAAEGV

Function and Significance

Apocytochrome f (petA) is a critical component of the cytochrome b6-f complex, which mediates electron transfer between photosystem II and photosystem I in photosynthetic organisms . This complex oxidizes plastoquinol and reduces plastocyanin, contributing to the proton gradient across the thylakoid membrane that drives ATP synthesis .

Applications in Research

Recombinant Apocytochrome f (petA) is utilized in various research applications, including:

  • Structural studies: Determining the protein's three-dimensional structure to understand its function .

  • Biochemical assays: Investigating its redox properties and interactions with other components of the photosynthetic electron transport chain .

  • Spectroscopic analysis: Examining its light absorption and electron transfer characteristics .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for fulfillment according to your requirements.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
If you require a specific tag type, please inform us, and we will prioritize its development.
Synonyms
petA; PMM0461; Cytochrome f
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
35-317
Protein Length
Full Length of Mature Protein
Species
Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / NIES-2087 / MED4)
Target Names
petA
Target Protein Sequence
YPFWAQQNYESPREATGKIVCANCHLAQMPTIAEVPQSVGADSVFKAVVKIPYKDDIKEI GADGSAVPLQVGAVVMLPDGFKLAPQERWTDEIKEETEGVYFTNYSEEKDNIILVGPLPG DTNKEIVFPVLSPNPATNKEYHYGKYSLHIGGNRGRGQVYPTGEKSNNVIFTSSSAGTIN SIETIEDGSYQINIENENGDIVTEAVPVGPKLIVKEQDQISAGDPLTNDPNVGGFGQLDA EVVLQSPYRIIGLIAFFIGVGLTQILLVLKKKQVEKVQAAEGV
Uniprot No.

Target Background

Function
A component of the cytochrome b6-f complex, mediating electron transfer between Photosystem II (PSII) and Photosystem I (PSI), cyclic electron flow around PSI, and state transitions.
Database Links

KEGG: pmm:PMM0461

STRING: 59919.PMM0461

Protein Families
Cytochrome f family
Subcellular Location
Cellular thylakoid membrane; Single-pass membrane protein.

Q&A

What is Apocytochrome f (petA) in Prochlorococcus marinus?

Apocytochrome f is the precursor form of cytochrome f, a critical component of the cytochrome b6f complex involved in photosynthetic electron transport in Prochlorococcus marinus. Cytochrome f is encoded by the petA gene, which is located in the chloroplast genome of this cyanobacterium. The "apo" prefix indicates the protein without its heme group, which is attached post-translationally to form the mature, functional cytochrome f. In Prochlorococcus, as in other photosynthetic organisms, cytochrome f plays an essential role in transferring electrons between photosystem II and photosystem I, making it crucial for photosynthetic function and, consequently, cellular growth and survival .

How is the expression of petA regulated in Prochlorococcus marinus?

The expression of petA in Prochlorococcus marinus, like in other cyanobacteria, is regulated at multiple levels. While specific research on Prochlorococcus petA regulation is limited in the provided sources, studies in related organisms like Chlamydomonas reinhardtii reveal that petA expression involves specialized translational activators. For instance, in Chlamydomonas, a nuclear-encoded factor called TCA1 (Translation of Cytochrome b6f petA mRNA) specifically activates the translation of petA mRNA by interacting with its 5' untranslated region (5'UTR) . The regulation involves intricate interactions between nuclear and chloroplast genomes, with nuclear-encoded factors governing the expression of chloroplast genes like petA. Mutants lacking functional TCA1 fail to synthesize cytochrome f despite normal petA mRNA levels, demonstrating the critical role of translational regulation in petA expression .

What environmental factors affect petA expression in Prochlorococcus?

Environmental factors significantly influence petA expression in Prochlorococcus, reflecting the organism's adaptation to diverse marine environments. One critical factor is carbon dioxide concentration. Research demonstrates that elevated pCO2 conditions (projected year 2100 levels) significantly reduce Prochlorococcus growth as measured by Malthusian growth rates, while leaving exponential growth rates unaffected . This impact on growth may involve changes in photosynthetic efficiency, potentially affecting the expression and function of photosynthetic components like cytochrome f.

The discrepancy between growth metrics reveals that elevated pCO2 primarily affects post-transfer recovery rather than steady-state growth, suggesting that environmental stress alters the expression or function of photosynthetic proteins during adaptation phases. Specifically, Prochlorococcus strain MIT9312 showed substantial mortality events upon exposure to fresh media with elevated pCO2, indicating complex interactions between environmental conditions and cellular physiology that may involve photosynthetic electron transport components .

What expression systems are effective for recombinant Prochlorococcus proteins?

The typical methodology involves:

  • PCR amplification of the target gene from Prochlorococcus genomic DNA

  • Cloning into appropriate expression vectors (commonly pET series)

  • Transformation into E. coli expression strains (commonly BL21 or derivatives)

  • Induction with IPTG at optimized concentrations and temperatures

  • Purification using affinity chromatography (commonly His-tag purification)

This approach typically yields 5-10 mg of purified protein per liter of cell culture for proteins like ProcM . For membrane proteins like cytochrome f, additional optimization steps including detergent screening and membrane fraction isolation may be required.

What purification strategies are optimal for recombinant Prochlorococcus Apocytochrome f?

Purification of recombinant Prochlorococcus Apocytochrome f requires specialized strategies due to its nature as a membrane-associated protein. Based on established methodologies for similar proteins, an effective purification protocol typically follows this workflow:

  • Cell lysis and membrane fraction isolation: After expression in a suitable host (typically E. coli), cells are disrupted via sonication or French press in buffer containing protease inhibitors. Differential centrifugation separates membrane fractions containing the recombinant protein.

  • Solubilization: Membrane proteins require detergent solubilization. For apocytochrome f, mild non-ionic detergents such as n-dodecyl-β-D-maltoside (DDM) at 1-2% concentration effectively solubilize the protein while maintaining its native-like structure.

  • Affinity chromatography: His6-tagged proteins can be purified using cobalt or nickel affinity chromatography. Research shows that cobalt affinity chromatography can yield 5-10 mg of purified protein per liter of cell culture for Prochlorococcus proteins .

  • Size exclusion chromatography: This step removes aggregates and provides additional purification while simultaneously exchanging the protein into a buffer with reduced detergent concentration (typically 0.02-0.05% DDM).

  • Quality assessment: Analysis of the purified protein by SDS-PAGE, spectroscopic methods (if applicable), and potentially mass spectrometry ensures proper identification and purity.

For researchers working with recombinant apocytochrome f specifically, it's critical to verify that the purified protein lacks heme incorporation, distinguishing it from mature cytochrome f.

How can researchers verify successful expression of recombinant Prochlorococcus petA?

Verification of successful recombinant Prochlorococcus petA expression requires multiple complementary approaches to confirm both identity and functionality. The following comprehensive methodology ensures reliable verification:

  • SDS-PAGE and Western blotting: Express the recombinant protein with an affinity tag (commonly His6) and analyze via SDS-PAGE to verify molecular weight. Western blotting using anti-His antibodies or specific antibodies against cytochrome f confirms identity. Comparisons with wild-type and mutant controls (e.g., ΔpetA strains) provide further verification .

  • Mass spectrometry: MALDI-TOF MS or ESI-MS analysis of the purified protein confirms molecular weight and can detect post-translational modifications. For detailed analysis, tandem mass spectrometry (MS/MS) provides sequence confirmation, as demonstrated in studies of other Prochlorococcus proteins .

  • RNA analysis: RT-PCR or northern blotting confirms transcription of the recombinant gene. This approach has been successfully employed to detect expression of other Prochlorococcus genes .

  • Spectroscopic analysis: For apocytochrome f specifically, absence of characteristic absorption peaks associated with heme confirms the protein is in its "apo" form rather than the mature cytochrome.

  • Functional complementation: In some cases, researchers can verify functionality by demonstrating that the recombinant protein complements growth defects in mutant strains lacking functional petA, though this requires appropriate expression systems.

How can site-directed mutagenesis of recombinant petA advance understanding of Prochlorococcus photosynthesis?

Site-directed mutagenesis of recombinant petA provides a powerful approach for deciphering structure-function relationships in Prochlorococcus photosynthesis. By systematically altering specific amino acid residues, researchers can:

  • Identify critical residues for electron transfer: Mutations of residues near the heme binding site can reveal those essential for electron transport between photosystems, illuminating the mechanistic basis of Prochlorococcus's adaptation to low-light environments.

  • Investigate protein-protein interactions: Modifications to surface residues can disrupt or enhance interactions with other components of the cytochrome b6f complex or with plastocyanin/cytochrome c6, its electron transfer partners. This approach parallels the strategy used in studying ring topology of Prochlorococcus peptides, where a series of mutants was generated to disrupt individual rings by mutating Ser or Thr to Ala, followed by ESI-MSMS analysis to determine structure-function relationships .

  • Examine environmental adaptations: Comparing the effects of mutations across different Prochlorococcus ecotypes can reveal how cytochrome f has evolved to function optimally under different light and nutrient conditions. This is particularly relevant given that Prochlorococcus strains show differential sensitivity to environmental factors such as elevated pCO2 .

  • Study translational regulation: Creating chimeric constructs with modified 5'UTRs, similar to the AFFF and FKR12 constructs described in research on Chlamydomonas, can help identify regulatory elements controlling petA translation . This approach revealed that the 5'UTR of petA mRNA is a target for translational regulation by nuclear-encoded factors.

The methodology typically involves QuikChange or overlapping PCR techniques for mutation introduction, followed by expression in appropriate hosts and functional characterization through spectroscopic, biochemical, and cellular assays .

What approaches can resolve expression challenges with recombinant Prochlorococcus proteins?

Recombinant expression of Prochlorococcus proteins, including apocytochrome f, presents several challenges that can be addressed through tailored methodological approaches:

  • Codon optimization: Prochlorococcus genes often contain rare codons that limit expression in E. coli. Synthetic gene synthesis with codon optimization for the expression host can significantly improve yields. This approach has proven effective for expressing other challenging cyanobacterial proteins.

  • Fusion partners: Expression as fusion proteins with solubility-enhancing partners such as MBP (maltose-binding protein), SUMO, or Thioredoxin can improve folding and solubility. For example, research demonstrates that His6-tagged fusion proteins of Prochlorococcus peptides can be successfully expressed, albeit often in insoluble form requiring specialized purification protocols .

  • Expression conditions optimization: Systematic testing of induction temperatures (typically lowering to 16-20°C), inducer concentrations, and expression duration can dramatically improve yields and solubility. The expression protocol used for ProcM, which yielded 5-10 mg/L, provides a starting point for optimization .

  • Alternative expression systems: When E. coli fails to produce functional protein, alternative hosts such as cyanobacterial expression systems or cell-free expression systems can be employed. For photosynthetic proteins specifically, expression in cyanobacterial hosts may provide the necessary machinery for proper folding and cofactor incorporation.

  • Refolding protocols: For proteins expressed in inclusion bodies, optimization of denaturation and refolding conditions using a factorial design approach can recover functional protein. This typically involves screening various combinations of pH, ionic strength, and additives such as arginine or glycerol during the refolding process.

How does the cytochrome b6f complex organization in Prochlorococcus compare to other photosynthetic organisms?

The cytochrome b6f complex in Prochlorococcus exhibits distinctive organizational features that reflect its evolutionary adaptation to oligotrophic marine environments. While direct comparative structural data is limited in the provided sources, several key aspects of Prochlorococcus cytochrome b6f organization can be inferred:

  • Streamlined architecture: Prochlorococcus, with its minimal genome, likely maintains only essential components of the cytochrome b6f complex, potentially lacking some auxiliary subunits found in plants and other cyanobacteria. This streamlining parallels the remarkable diversity observed in other Prochlorococcus protein systems, such as the prochlorosins, where a single enzyme (ProcM) can process 29 different peptide substrates with high specificity .

  • Adaptation to low-iron environments: Prochlorococcus thrives in iron-limited oceanic regions, suggesting potential adaptations in its cytochrome b6f complex to minimize iron requirements while maintaining electron transport efficiency. This adaptation may involve structural modifications to the cytochrome f component.

  • Regulatory differences: The translational regulation of cytochrome f appears to involve distinct mechanisms across photosynthetic organisms. In Chlamydomonas, the nuclear-encoded TCA1 factor specifically activates translation of petA mRNA by interacting with its 5'UTR . Prochlorococcus likely employs similar but distinct translational regulation systems, possibly with greater efficiency given its streamlined genome.

  • Environmental responsiveness: Prochlorococcus shows differential growth responses to environmental factors such as elevated pCO2, with specific strains like MIT9312 exhibiting substantial sensitivity . This suggests that the organization and regulation of photosynthetic complexes, including cytochrome b6f, may be uniquely tuned to respond to environmental conditions in ways that differ from other photosynthetic organisms.

What analytical methods are most effective for studying recombinant Prochlorococcus Apocytochrome f structure?

Multiple complementary analytical approaches provide comprehensive structural information about recombinant Prochlorococcus Apocytochrome f:

  • X-ray crystallography: While challenging due to the membrane protein nature of apocytochrome f, crystallization trials using vapor diffusion methods with specific detergents (typically DDM or C12E8) can yield diffraction-quality crystals. Successful crystallization often requires screening hundreds of conditions and may benefit from lipidic cubic phase approaches.

  • Cryo-electron microscopy (cryo-EM): For structural analysis without crystallization, single-particle cryo-EM provides an alternative approach for determining the structure of apocytochrome f, particularly when studied as part of the intact cytochrome b6f complex.

  • Mass spectrometry: Native mass spectrometry and hydrogen-deuterium exchange mass spectrometry (HDX-MS) provide information about protein conformation and dynamics. For detailed analysis of post-translational modifications or structural features, techniques like electrospray ionization mass spectrometry (ESI-MS) with collision-induced dissociation can reveal fragmentation patterns indicative of structural elements, similar to the approach used for analyzing the structure of prochlorosins .

  • Circular dichroism (CD) spectroscopy: CD provides information about secondary structure content and stability. Far-UV CD (190-250 nm) reveals α-helical and β-sheet content, while thermal denaturation studies assess structural stability.

  • NMR spectroscopy: While challenging for large membrane proteins, specific isotopic labeling (15N, 13C) of recombinant apocytochrome f can enable NMR studies of specific domains or interactions, providing atomic-level structural information about dynamic regions.

The combination of these methods provides complementary structural information, from secondary structure to atomic-level details, enabling comprehensive characterization of recombinant Prochlorococcus apocytochrome f.

How can researchers optimize growth conditions for Prochlorococcus cultures to enhance recombinant protein studies?

Optimizing Prochlorococcus growth conditions is critical for obtaining sufficient biomass for recombinant protein studies. A comprehensive approach includes:

The following table summarizes optimal growth conditions for different Prochlorococcus ecotypes:

EcotypeTemperature (°C)Light (μmol photons m⁻² s⁻¹)MediaTypical Doubling Time (hours)
HL (MIT9312-like)22-2440-80Pro99/PCR-S1124-36
LL (MIT9313-like)20-2210-30Pro99/PCR-S1140-60

What transcriptional and translational factors influence petA expression in Prochlorococcus?

The expression of petA in Prochlorococcus is regulated by a sophisticated interplay of transcriptional and translational factors that coordinate chloroplast gene expression with cellular needs and environmental conditions:

  • Translational activators: While specific factors for Prochlorococcus petA have not been directly identified in the provided sources, research in related organisms like Chlamydomonas reinhardtii reveals the critical role of nuclear-encoded translational activators such as TCA1. These factors specifically recognize the 5'UTR of petA mRNA to activate translation . Mutants lacking functional TCA1 fail to synthesize cytochrome f despite normal petA mRNA levels, highlighting the importance of translational regulation .

  • 5'UTR regulatory elements: The untranslated region of petA mRNA contains important regulatory elements that serve as targets for translational regulation. Experiments with chimeric genes demonstrate that substituting the natural petA 5'UTR with alternative 5'UTRs (such as the atpA 5'UTR) can alter the translational control mechanisms, making expression independent of specific translational activators .

  • Environmental response mechanisms: Transcriptional and translational regulation of photosynthetic genes in Prochlorococcus responds to environmental cues. Research shows that elevated pCO2 conditions significantly reduce Prochlorococcus growth, potentially through mechanisms involving altered expression of photosynthetic components . This responsiveness likely involves specific transcription factors that integrate environmental signals.

  • Post-transcriptional processing: The processing and stability of petA mRNA contributes to its translational efficiency. In Chlamydomonas, changes in petA mRNA levels were not observed in mutants deficient in cytochrome f translation, indicating that translational control rather than transcriptional or post-transcriptional regulation is the primary control point . Similar mechanisms may operate in Prochlorococcus.

Understanding these regulatory mechanisms provides insights for designing expression systems for recombinant Prochlorococcus proteins and for interpreting the physiological responses of this important marine cyanobacterium to changing environmental conditions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.