Recombinant Prochlorococcus marinus subsp. pastoris ATP synthase subunit a (atpB)
Description
Definition and Biological Context
The recombinant ATP synthase subunit a (atpB) is a 241-amino acid transmembrane protein encoded by the atpB gene (UniProt ID: Q7V032) in Prochlorococcus marinus subsp. pastoris. This subunit forms part of the F0 sector of ATP synthase, which facilitates proton translocation across membranes during ATP production . Prochlorococcus is a marine cyanobacterium responsible for 30–80% of photosynthesis in oligotrophic oceans, making its ATP synthase a key target for understanding global carbon cycling .
Primary Structure
-
Amino Acid Sequence:
MFLNSLPTNFAALEVGQHLYWQIGNIRLHGQVFLTSWILLGALLVFISVGTKKMENDPKG LQNLLEFLWDYIRDLSRTQIGEKVYRDWMPFIGTLFLFVFVSNWGGALIPWRLIKLPSGE LGAPTADINTTIALALLVSLSYFYAGLSNKGWRYFEYYVHPTPIMLPFKILEDFTKPLSL SFRLFGNILADELVVGVLVFLVPLVLPIPVMFLGLFTSAIQALIFATLAAYYIGEAVEEH H. -
Domains: Contains transmembrane helices critical for proton channel formation in the F0 sector .
Gene Information
| Parameter | Details |
|---|---|
| Gene Name | atpB |
| Synonyms | atpI, PMM1456 |
| Locus Tag | PMM1456 |
| Protein Function | ATP synthase F0 sector subunit a; essential for proton translocation |
Production Overview
-
Expression System: Escherichia coli with N-terminal His-tag .
-
Form: Lyophilized powder in Tris/PBS-based buffer with 6% trehalose (pH 8.0) .
Functional Studies
-
Mechanistic Insights: Used to map proton transport pathways in ATP synthase .
-
Ecophysiology: Links Prochlorococcus’s ATP synthesis efficiency to its dominance in low-nutrient marine environments .
Technical Considerations
Ecological and Evolutionary Significance
-
Genomic Adaptation: The atpB gene’s conservation in Prochlorococcus reflects evolutionary optimization for oligotrophic oceans .
-
Climate Impact: Insights into ATP synthase efficiency could model oceanic carbon flux under climate change .
Limitations and Future Directions
Product Specs
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it during order placement, and we will accommodate your request.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate with us in advance, as additional fees will apply.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Target Background
KEGG: pmm:PMM1456
STRING: 59919.PMM1456
