Name: Recombinant Prochlorococcus marinus subsp. pastoris ATP synthase subunit b (atpF).
Source Organism: Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) .
Protein Names: ATP synthase subunit b, ATP synthase F(0) sector subunit b, ATPase subunit I, F-type ATPase subunit b, or F-ATPase subunit b .
ATP synthase is a complex molecular machine that produces ATP (adenosine triphosphate), the primary energy currency of cells. It consists of two main parts: F0 and F1. The F0 sector is a transmembrane channel that allows protons to flow across the membrane, while the F1 sector uses the energy from this proton flow to synthesize ATP .
Subunit b (atpF) is a component of the F0 sector and is crucial for the structural integrity and function of the ATP synthase complex . It helps to connect the F0 and F1 sectors, ensuring efficient energy transfer .
Recombinant ATP synthase subunit b (atpF) is produced using genetic engineering techniques. The gene encoding atpF from Prochlorococcus marinus subsp. pastoris is inserted into an expression vector, which is then introduced into a host organism such as E. coli for protein production . The recombinant protein can then be purified for research and industrial applications .
Recombinant Prochlorococcus marinus subsp. pastoris ATP synthase subunit b (atpF) has several potential applications:
Research: Studying the structure and function of ATP synthase .
Drug Discovery: Identifying inhibitors of ATP synthase as potential antibacterial agents .
The amino acid sequence of Prochlorococcus marinus subsp. pastoris ATP synthase subunit b (atpF) is as follows :
MNLPLLATEGFGLNLNLFETNVLNWAVVVFGLYKFLPGFLGKmLQKRREGILLELKDAEDRLLKATQALEKAKTDLSLAEEKAGQIKADSLKRSESIRMESEKKAIEEMARIKQSAISDESS EASRAISQLRKEAVELAIKKALDSLPNRLDQTTQENLVTQSINNIEMN
While specific experimental data for recombinant Prochlorococcus marinus subsp. pastoris ATP synthase subunit b (atpF) is limited, studies on ATP synthase in other organisms provide relevant insights:
Inhibition Studies: Piceatannol, a polyphenolic inhibitor, can inhibit ATP synthase activity by interacting with subunits α, β, and γ .
Functional Studies: ATP synthase is crucial for energy production in various organisms, including bacteria and fungi .
Glucose Uptake: Transcriptomic and proteomic changes can be induced by glucose addition in Prochlorococcus strains .
ELISA kits for Recombinant Prochlorococcus marinus subsp. pastoris ATP synthase subunit b(atpF) are available .
F1F0 ATP synthase synthesizes ATP from ADP using a proton or sodium gradient. This enzyme comprises two domains: F1, the extramembraneous catalytic core; and F0, the membrane proton channel. These domains are connected by a central and peripheral stalk. ATP synthesis in the F1 catalytic domain is coupled to proton translocation via the central stalk's rotary mechanism. This protein is a component of the F0 channel and forms part of the peripheral stalk, linking F1 and F0.
KEGG: pmm:PMM1453
STRING: 59919.PMM1453
Prochlorococcus marinus is a marine cyanobacterium that dominates photosynthetic activity in the ocean. It exists in two main ecological forms: high-light-adapted genotypes found in the upper water column and low-light-adapted genotypes (like P. marinus SS120) found at the bottom of the illuminated layer. P. marinus SS120 has one of the smallest genomes of any photosynthetic organism, with 1,751,080 bp and an average G+C content of 36.4% . The organism contains essential photosynthetic and energy production genes, including those for ATP synthase. Studying ATP synthase components from this minimal genome organism provides insights into fundamental energy conversion mechanisms that have evolved under extreme selective pressure in oligotrophic marine environments.
ATP synthase subunit b (atpF) is a critical component of the F₀ portion of F₁F₀-ATP synthase, anchored in the membrane. In cyanobacteria like Prochlorococcus, this complex spans the thylakoid membrane and functions using a rotary mechanism to synthesize ATP from ADP and inorganic phosphate using the proton gradient generated by photosynthetic electron transport. The subunit b forms a peripheral stalk that connects the membrane-embedded F₀ portion to the catalytic F₁ portion, preventing rotation of the α₃β₃ hexamer during ATP synthesis. Unlike many other photosynthetic genes in cyanobacteria, ATP synthase genes including atpF are typically present as single copies in Prochlorococcus marinus SS120, reflecting the genome minimization that has occurred during its evolution .
Pichia pastoris (now known as Komagataella pastoris) offers several advantages as an expression system for cyanobacterial proteins:
Strong constitutive expression: The glyceraldehyde-3-phosphate dehydrogenase (GAP) promoter allows high-level constitutive expression of recombinant proteins, sometimes exceeding levels achieved with the inducible AOX1 promoter .
Post-translational modifications: As a eukaryotic system, P. pastoris can perform many post-translational modifications similar to higher eukaryotes.
Secretion capacity: Using vectors like pGAPZα, proteins can be fused to the Saccharomyces cerevisiae α-factor secretion signal, facilitating their export to the culture medium .
Genetic stability: P. pastoris maintains stable expression over many generations.
Growth to high cell density: The organism can achieve high biomass concentrations, enhancing protein yield.
The pGAPZ vector series provides options for creating fusion proteins with C-terminal tags (myc epitope and polyhistidine) for detection and purification, making them particularly suitable for expression of membrane proteins like ATP synthase components .
Creating optimal constructs requires strategic planning and consideration of multiple factors:
Codon optimization: Analyze and adapt the Prochlorococcus atpF gene codons to match P. pastoris codon usage preferences. This is particularly important since P. marinus SS120 has a distinct G+C content (36.4%) compared to P. pastoris.
Vector selection: Choose an appropriate pGAPZ vector based on your research needs:
Reading frame alignment: Select the correct reading frame variant (A, B, or C) to ensure in-frame fusion with C-terminal tags .
Fusion tag strategy: Consider whether C-terminal myc and polyhistidine tags might interfere with ATP synthase subunit b function and structure. For membrane proteins, N-terminal tags often preserve function better than C-terminal modifications.
Promoter considerations: While the constitutive GAP promoter provides high expression levels, evaluate whether the unregulated expression of a membrane protein might burden the cell's capacity for proper folding and assembly.
A methodological approach similar to that used for expressing the Pro1404 gene from P. marinus SS120 can be adapted, focusing on appropriate restriction enzyme selection and verification of successful integration .
For optimal purification of recombinant ATP synthase subunit b expressed in P. pastoris:
Membrane fraction isolation:
Harvest cells and disrupt using glass beads or mechanical disruption
Perform differential centrifugation to isolate membrane fractions
Use ultracentrifugation to separate different membrane populations
Detergent screening:
Test a panel of detergents (DDM, LDAO, Triton X-100) at various concentrations
Assess protein solubilization efficiency and retention of native structure
Monitor effects on downstream purification steps
Affinity chromatography:
Secondary purification:
Size exclusion chromatography to separate monomeric from aggregated protein
Ion exchange chromatography for further purification
Quality assessment:
This systematic approach can be adjusted based on specific experimental requirements and protein behavior.
Verifying proper folding and functionality of recombinant ATP synthase subunit b requires multiple complementary approaches:
Assembly assays:
Co-immunoprecipitation with other ATP synthase subunits
Blue native PAGE to evaluate complex formation
Crosslinking studies to assess proper subunit interactions
Structural integrity assessment:
Limited proteolysis to verify correct folding
Circular dichroism to confirm secondary structure elements
Thermal shift assays to determine stability
Functional reconstitution:
Incorporation into liposomes with other ATP synthase components
Measurement of proton translocation using pH-sensitive dyes
ATP synthesis/hydrolysis coupling efficiency determination
Comparative analysis:
Parallel examination of native ATP synthase from P. marinus
Complementation studies in ATP synthase-deficient strains
Structural analysis through cryo-electron microscopy of reconstituted complexes
When working with ATP synthase components, it's crucial to recognize that the protein functions as part of a complex multisubunit enzyme, and individual subunits may not display activity in isolation. Therefore, assembly verification should be prioritized in functional assessment.
The mitochondrial F₁F₀-ATP synthase can operate bidirectionally—synthesizing ATP when proton gradient is sufficient or hydrolyzing ATP to generate a proton gradient when the gradient is insufficient . This dual functionality creates significant challenges when studying cyanobacterial ATP synthases:
Experimental design considerations:
Create conditions that favor either synthesis or hydrolysis mode
Use specific inhibitors that preferentially affect one direction
Develop assays that can distinguish between the two activities
Inhibitor-based approaches:
Genetic engineering solutions:
Assay development:
Understanding this directional activity is particularly important in photosynthetic organisms like Prochlorococcus, where cyclic changes in light availability may require dynamic switching between synthetic and hydrolytic modes.
Expressing membrane proteins from Prochlorococcus in heterologous systems presents several unique challenges:
Lipid environment differences:
Cyanobacterial membranes differ significantly from eukaryotic membranes
P. pastoris may lack specific lipids required for proper folding
Consider supplementing growth media with lipids or using membrane-mimetic systems
Protein trafficking issues:
Membrane insertion mechanisms differ between prokaryotes and eukaryotes
Targeting signals may not be recognized correctly
Post-translational modifications may affect membrane insertion
Expression toxicity:
Overexpression of membrane proteins can disrupt host membrane integrity
Consider using tightly regulated inducible systems rather than constitutive GAP promoter
Evaluate expression in specialized P. pastoris strains with enhanced membrane protein expression capacity
Protein stability concerns:
ATP synthase subunits may be unstable without partner subunits
Co-expression of multiple subunits may be necessary
Design of stabilizing mutations or fusion partners may be required
G+C content adaptation:
These challenges can be addressed through careful experimental design and optimization strategies tailored to the specific properties of ATP synthase subunit b.
Addressing interspecies incompatibility requires multilevel intervention strategies:
Genetic optimization approaches:
Codon optimization beyond basic usage preferences, considering mRNA secondary structure
Removal of cryptic splice sites that might be recognized by the P. pastoris spliceosome
Elimination of internal Shine-Dalgarno-like sequences that might cause translational pausing
Expression enhancement strategies:
Co-expression of cyanobacterial chaperones to assist folding
Fusion to solubility-enhancing partners that can be later removed
Testing of various promoter strengths to find optimal expression levels
Membrane targeting optimization:
Testing different signal sequences beyond the standard α-factor
Creation of signal sequence libraries to identify optimal targeting
Engineering of the transmembrane domains to improve insertion efficiency
Host adaptation approaches:
Use of specialized P. pastoris strains with altered membrane composition
Engineering P. pastoris to produce cyanobacterial-specific lipids
Development of strains with reduced proteolytic activity
The methodology used for expressing Pro1404 from P. marinus SS120 in Synechococcus elongatus, where the gene was placed downstream of different kanamycin resistance cassettes with promoters of varying strengths (C.K1 for moderate and C.K3 for strong expression), provides a useful template for exploring expression optimization strategies .
When analyzing recombinant ATP synthase components, it's important to combine multiple methods to build a comprehensive understanding of both structural integrity and functional capacity. The choice of methods should be guided by specific research questions and available resources.
Systematic troubleshooting of low expression yields:
Transcriptional level analysis:
Quantify mRNA levels using RT-qPCR
Check for premature transcription termination
Evaluate promoter functionality in your specific construct
Translational efficiency assessment:
Perform polysome profiling to check for translation initiation issues
Consider redesigning the 5' UTR for improved ribosome binding
Evaluate rare codon usage patterns that might cause ribosomal stalling
Protein stability evaluation:
Add protease inhibitors during extraction
Test lower growth temperatures to slow folding
Evaluate different lysis conditions to preserve protein integrity
Expression strain optimization:
Test protease-deficient P. pastoris strains
Evaluate strains with different auxotrophies
Consider specialized strains engineered for membrane protein expression
Growth condition modification:
Optimize media composition (carbon source, nitrogen, trace elements)
Test various induction strategies if using inducible promoters
Evaluate the effect of growth phase on expression levels
The techniques used to express the Pro1404 gene in Synechococcus elongatus, where different promoter strengths were tested and transcriptional terminators were carefully positioned, can provide guidance for expression optimization .
Distinguishing between synthesis and hydrolysis activities requires specialized experimental approaches:
Differential inhibition analysis:
Directional assay design:
Establish opposing proton gradients to drive activity preferentially in one direction
Use caged substrates with light activation to initiate reactions from defined starting points
Develop real-time assays with directional indicators
Genetic modifications for functional bias:
Physiological condition manipulation:
Vary ATP/ADP ratios to favor one direction
Manipulate proton gradient magnitude and direction
Control redox state to influence enzyme conformation
In situ analysis techniques:
Super-resolution microscopy with potential-sensitive probes like TMRM
Real-time ATP sensing using genetically encoded biosensors
Simultaneous monitoring of membrane potential and ATP levels
These approaches can help researchers accurately characterize the complex bidirectional behavior of ATP synthase in experimental systems.
Prochlorococcus marinus has evolved to thrive in nutrient-poor oceanic environments with varying light conditions. Its ATP synthase likely reflects adaptations to maximize energy efficiency under these constraints. Future research directions include:
Comparative bioenergetic studies:
Analysis of ATP synthase efficiency across different Prochlorococcus ecotypes (high-light vs. low-light adapted strains)
Comparison with ATP synthases from diverse photosynthetic organisms
Investigation of regulatory mechanisms that may be unique to oligotrophic specialists
Structural adaptations investigation:
Detailed structural analysis of P. marinus ATP synthase to identify unique features
Examination of subunit stoichiometry and interactions under various environmental conditions
Investigation of potential structural modifications that enhance function under low energy input
Energy conservation mechanisms:
Exploration of how Prochlorococcus manages the balance between ATP synthesis and hydrolysis
Investigation of potential ATP synthase regulators similar to ATPIF1 that may be present in Prochlorococcus
Analysis of potential cross-talk between photosynthetic electron transport and ATP synthase regulation
The minimal genome of P. marinus SS120 (1.75 Mb) suggests strong selection pressure for retaining only essential functions, making its ATP synthase particularly interesting for understanding fundamental bioenergetic requirements.
The discovery that the Pro1404 glucose transporter from Prochlorococcus exhibits multiphasic transport kinetics with a high-affinity phase in the nanomolar range suggests important considerations for other recombinant protein studies:
Concentration-dependent behavior analysis:
Test protein function across wide concentration ranges (nano- to millimolar)
Develop assays capable of detecting activity at environmentally relevant concentrations
Investigate potential allosteric regulation mechanisms that drive multiphasic kinetics
Physiological relevance assessment:
Evaluate whether laboratory conditions reflect natural environmental concentrations
Consider how protein behavior changes across concentration gradients
Investigate whether multiphasic kinetics represent an adaptation to variable environmental conditions
Methodological implications:
Develop more sensitive assays for detecting activity at extremely low substrate concentrations
Design experiments to capture complete kinetic profiles rather than standard Michaelis-Menten parameters
Consider how expression system choice might affect kinetic properties of recombinant proteins
Structural dynamics investigation:
Explore potential conformational changes associated with different kinetic phases
Investigate oligomerization states that might explain multiphasic behavior
Examine potential post-translational modifications that could influence kinetics
These insights from transport proteins like Pro1404 may have broader implications for studying ATP synthase components, particularly regarding concentration-dependent assembly and functional properties.
Recent research on the dual function of ATP synthase has revealed potential therapeutic approaches for mitochondrial diseases . This has parallels for research on cyanobacterial ATP synthase:
Inhibitor development strategies:
Regulatory mechanism exploration:
Investigate whether cyanobacteria possess ATPIF1-like regulatory proteins
Explore potential for engineering regulatory elements from cyanobacteria into eukaryotic systems
Study how photosynthetic organisms balance ATP synthesis/hydrolysis during light/dark transitions
Bioenergetic intervention applications:
Explore potential for targeting ATP synthase in photosynthetic pathogens
Investigate applications in controlling harmful algal blooms
Develop biotechnological applications for enhanced biofuel production
Evolutionary insights:
Compare regulatory mechanisms across evolutionary lineages
Investigate how endosymbiosis events influenced ATP synthase regulation
Explore potential for hybrid systems combining features from different organisms
The research by Acin-Perez et al. (2023) showing that selective inhibition of ATP hydrolysis with (+)-epicatechin improved outcomes in disease models suggests parallel approaches might be beneficial in various research contexts.