Recombinant Prochlorococcus marinus subsp. pastoris ATP synthase subunit b (atpF)

Shipped with Ice Packs
In Stock

Description

General Information

  • Name: Recombinant Prochlorococcus marinus subsp. pastoris ATP synthase subunit b (atpF).

  • Source Organism: Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) .

  • Protein Names: ATP synthase subunit b, ATP synthase F(0) sector subunit b, ATPase subunit I, F-type ATPase subunit b, or F-ATPase subunit b .

  • Gene Name: atpF .

  • Ordered Locus Names: PMM1453 .

  • UniProt Accession Number: Q7V035 .

  • Sequence Length: 1-170 amino acids .

Structure and Function

ATP synthase is a complex molecular machine that produces ATP (adenosine triphosphate), the primary energy currency of cells. It consists of two main parts: F0 and F1. The F0 sector is a transmembrane channel that allows protons to flow across the membrane, while the F1 sector uses the energy from this proton flow to synthesize ATP .

Subunit b (atpF) is a component of the F0 sector and is crucial for the structural integrity and function of the ATP synthase complex . It helps to connect the F0 and F1 sectors, ensuring efficient energy transfer .

Recombinant Production

Recombinant ATP synthase subunit b (atpF) is produced using genetic engineering techniques. The gene encoding atpF from Prochlorococcus marinus subsp. pastoris is inserted into an expression vector, which is then introduced into a host organism such as E. coli for protein production . The recombinant protein can then be purified for research and industrial applications .

Applications

Recombinant Prochlorococcus marinus subsp. pastoris ATP synthase subunit b (atpF) has several potential applications:

  • Research: Studying the structure and function of ATP synthase .

  • Drug Discovery: Identifying inhibitors of ATP synthase as potential antibacterial agents .

  • Biotechnology: Developing new methods for ATP production .

Sequence Information

The amino acid sequence of Prochlorococcus marinus subsp. pastoris ATP synthase subunit b (atpF) is as follows :

MNLPLLATEGFGLNLNLFETNVLNWAVVVFGLYKFLPGFLGKmLQKRREGILLELKDAEDRLLKATQALEKAKTDLSLAEEKAGQIKADSLKRSESIRMESEKKAIEEMARIKQSAISDESS EASRAISQLRKEAVELAIKKALDSLPNRLDQTTQENLVTQSINNIEMN

Experimental Data

While specific experimental data for recombinant Prochlorococcus marinus subsp. pastoris ATP synthase subunit b (atpF) is limited, studies on ATP synthase in other organisms provide relevant insights:

  • Inhibition Studies: Piceatannol, a polyphenolic inhibitor, can inhibit ATP synthase activity by interacting with subunits α, β, and γ .

  • Functional Studies: ATP synthase is crucial for energy production in various organisms, including bacteria and fungi .

  • Glucose Uptake: Transcriptomic and proteomic changes can be induced by glucose addition in Prochlorococcus strains .

ELISA Kit Information

ELISA kits for Recombinant Prochlorococcus marinus subsp. pastoris ATP synthase subunit b(atpF) are available .

  • Quantity: 50 µg. Other quantities may be available upon inquiry .

  • Storage Buffer: Tris-based buffer, 50% glycerol, optimized for this protein .

  • Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
Tag type is determined during production. If a specific tag type is required, please inform us for preferential development.
Synonyms
atpF; PMM1453; ATP synthase subunit b; ATP synthase F(0 sector subunit b; ATPase subunit I; F-type ATPase subunit b; F-ATPase subunit b
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-170
Protein Length
full length protein
Species
Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / NIES-2087 / MED4)
Target Names
atpF
Target Protein Sequence
MNLPLLATEGFGLNLNLFETNVLNWAVVVFGLYKFLPGFLGKMLQKRREGILLELKDAED RLLKATQALEKAKTDLSLAEEKAGQIKADSLKRSESIRMESEKKAIEEMARIKQSAISDE SSEASRAISQLRKEAVELAIKKALDSLPNRLDQTTQENLVTQSINNIEMN
Uniprot No.

Target Background

Function

F1F0 ATP synthase synthesizes ATP from ADP using a proton or sodium gradient. This enzyme comprises two domains: F1, the extramembraneous catalytic core; and F0, the membrane proton channel. These domains are connected by a central and peripheral stalk. ATP synthesis in the F1 catalytic domain is coupled to proton translocation via the central stalk's rotary mechanism. This protein is a component of the F0 channel and forms part of the peripheral stalk, linking F1 and F0.

Database Links

KEGG: pmm:PMM1453

STRING: 59919.PMM1453

Protein Families
ATPase B chain family
Subcellular Location
Cellular thylakoid membrane; Single-pass membrane protein.

Q&A

What is Prochlorococcus marinus and why is it significant for ATP synthase research?

Prochlorococcus marinus is a marine cyanobacterium that dominates photosynthetic activity in the ocean. It exists in two main ecological forms: high-light-adapted genotypes found in the upper water column and low-light-adapted genotypes (like P. marinus SS120) found at the bottom of the illuminated layer. P. marinus SS120 has one of the smallest genomes of any photosynthetic organism, with 1,751,080 bp and an average G+C content of 36.4% . The organism contains essential photosynthetic and energy production genes, including those for ATP synthase. Studying ATP synthase components from this minimal genome organism provides insights into fundamental energy conversion mechanisms that have evolved under extreme selective pressure in oligotrophic marine environments.

What is the structure and function of ATP synthase subunit b (atpF) in cyanobacteria?

ATP synthase subunit b (atpF) is a critical component of the F₀ portion of F₁F₀-ATP synthase, anchored in the membrane. In cyanobacteria like Prochlorococcus, this complex spans the thylakoid membrane and functions using a rotary mechanism to synthesize ATP from ADP and inorganic phosphate using the proton gradient generated by photosynthetic electron transport. The subunit b forms a peripheral stalk that connects the membrane-embedded F₀ portion to the catalytic F₁ portion, preventing rotation of the α₃β₃ hexamer during ATP synthesis. Unlike many other photosynthetic genes in cyanobacteria, ATP synthase genes including atpF are typically present as single copies in Prochlorococcus marinus SS120, reflecting the genome minimization that has occurred during its evolution .

Why use Pichia pastoris as an expression system for cyanobacterial proteins?

Pichia pastoris (now known as Komagataella pastoris) offers several advantages as an expression system for cyanobacterial proteins:

  • Strong constitutive expression: The glyceraldehyde-3-phosphate dehydrogenase (GAP) promoter allows high-level constitutive expression of recombinant proteins, sometimes exceeding levels achieved with the inducible AOX1 promoter .

  • Post-translational modifications: As a eukaryotic system, P. pastoris can perform many post-translational modifications similar to higher eukaryotes.

  • Secretion capacity: Using vectors like pGAPZα, proteins can be fused to the Saccharomyces cerevisiae α-factor secretion signal, facilitating their export to the culture medium .

  • Genetic stability: P. pastoris maintains stable expression over many generations.

  • Growth to high cell density: The organism can achieve high biomass concentrations, enhancing protein yield.

The pGAPZ vector series provides options for creating fusion proteins with C-terminal tags (myc epitope and polyhistidine) for detection and purification, making them particularly suitable for expression of membrane proteins like ATP synthase components .

How can I design optimal recombinant constructs for Prochlorococcus ATP synthase subunit b expression in Pichia pastoris?

Creating optimal constructs requires strategic planning and consideration of multiple factors:

  • Codon optimization: Analyze and adapt the Prochlorococcus atpF gene codons to match P. pastoris codon usage preferences. This is particularly important since P. marinus SS120 has a distinct G+C content (36.4%) compared to P. pastoris.

  • Vector selection: Choose an appropriate pGAPZ vector based on your research needs:

    • pGAPZ A, B, or C (2.9 kb) for intracellular expression

    • pGAPZα A, B, or C (3.1 kb) for secreted expression with the α-factor signal sequence

  • Reading frame alignment: Select the correct reading frame variant (A, B, or C) to ensure in-frame fusion with C-terminal tags .

  • Fusion tag strategy: Consider whether C-terminal myc and polyhistidine tags might interfere with ATP synthase subunit b function and structure. For membrane proteins, N-terminal tags often preserve function better than C-terminal modifications.

  • Promoter considerations: While the constitutive GAP promoter provides high expression levels, evaluate whether the unregulated expression of a membrane protein might burden the cell's capacity for proper folding and assembly.

A methodological approach similar to that used for expressing the Pro1404 gene from P. marinus SS120 can be adapted, focusing on appropriate restriction enzyme selection and verification of successful integration .

What purification strategies are most effective for recombinant ATP synthase subunit b from P. pastoris?

For optimal purification of recombinant ATP synthase subunit b expressed in P. pastoris:

  • Membrane fraction isolation:

    • Harvest cells and disrupt using glass beads or mechanical disruption

    • Perform differential centrifugation to isolate membrane fractions

    • Use ultracentrifugation to separate different membrane populations

  • Detergent screening:

    • Test a panel of detergents (DDM, LDAO, Triton X-100) at various concentrations

    • Assess protein solubilization efficiency and retention of native structure

    • Monitor effects on downstream purification steps

  • Affinity chromatography:

    • If using His-tagged constructs, perform immobilized metal affinity chromatography (IMAC) using ProBond™ resin

    • Consider mild elution conditions to maintain protein stability

    • Implement on-column detergent exchange if necessary

  • Secondary purification:

    • Size exclusion chromatography to separate monomeric from aggregated protein

    • Ion exchange chromatography for further purification

  • Quality assessment:

    • SDS-PAGE and Western blotting (using anti-myc antibodies for detection)

    • Mass spectrometry for identity confirmation

    • Circular dichroism for secondary structure analysis

This systematic approach can be adjusted based on specific experimental requirements and protein behavior.

What functional assays can verify the proper folding and activity of recombinant atpF protein?

Verifying proper folding and functionality of recombinant ATP synthase subunit b requires multiple complementary approaches:

  • Assembly assays:

    • Co-immunoprecipitation with other ATP synthase subunits

    • Blue native PAGE to evaluate complex formation

    • Crosslinking studies to assess proper subunit interactions

  • Structural integrity assessment:

    • Limited proteolysis to verify correct folding

    • Circular dichroism to confirm secondary structure elements

    • Thermal shift assays to determine stability

  • Functional reconstitution:

    • Incorporation into liposomes with other ATP synthase components

    • Measurement of proton translocation using pH-sensitive dyes

    • ATP synthesis/hydrolysis coupling efficiency determination

  • Comparative analysis:

    • Parallel examination of native ATP synthase from P. marinus

    • Complementation studies in ATP synthase-deficient strains

    • Structural analysis through cryo-electron microscopy of reconstituted complexes

When working with ATP synthase components, it's crucial to recognize that the protein functions as part of a complex multisubunit enzyme, and individual subunits may not display activity in isolation. Therefore, assembly verification should be prioritized in functional assessment.

How can I address the dual function problem when studying ATP synthase from Prochlorococcus?

The mitochondrial F₁F₀-ATP synthase can operate bidirectionally—synthesizing ATP when proton gradient is sufficient or hydrolyzing ATP to generate a proton gradient when the gradient is insufficient . This dual functionality creates significant challenges when studying cyanobacterial ATP synthases:

  • Experimental design considerations:

    • Create conditions that favor either synthesis or hydrolysis mode

    • Use specific inhibitors that preferentially affect one direction

    • Develop assays that can distinguish between the two activities

  • Inhibitor-based approaches:

    • Consider compounds like (+)-epicatechin (EPI) that selectively inhibit ATP hydrolysis without affecting ATP synthesis

    • Evaluate oligomycin sensitivity to distinguish between forward and reverse activity

    • Test pH-dependent inhibitors that may differentially affect the two modes

  • Genetic engineering solutions:

    • Introduce mutations that favor synthesis over hydrolysis

    • Express modified versions of regulatory proteins similar to mammalian ATPIF1

    • Create chimeric constructs with selective functionality

  • Assay development:

    • Design real-time monitoring systems for ATP synthesis/hydrolysis

    • Employ membrane potential indicators like TMRM to track energy state

    • Develop in vivo assays that can measure directional activity in intact cells

Understanding this directional activity is particularly important in photosynthetic organisms like Prochlorococcus, where cyclic changes in light availability may require dynamic switching between synthetic and hydrolytic modes.

What are the challenges in expressing membrane proteins from Prochlorococcus in heterologous systems?

Expressing membrane proteins from Prochlorococcus in heterologous systems presents several unique challenges:

  • Lipid environment differences:

    • Cyanobacterial membranes differ significantly from eukaryotic membranes

    • P. pastoris may lack specific lipids required for proper folding

    • Consider supplementing growth media with lipids or using membrane-mimetic systems

  • Protein trafficking issues:

    • Membrane insertion mechanisms differ between prokaryotes and eukaryotes

    • Targeting signals may not be recognized correctly

    • Post-translational modifications may affect membrane insertion

  • Expression toxicity:

    • Overexpression of membrane proteins can disrupt host membrane integrity

    • Consider using tightly regulated inducible systems rather than constitutive GAP promoter

    • Evaluate expression in specialized P. pastoris strains with enhanced membrane protein expression capacity

  • Protein stability concerns:

    • ATP synthase subunits may be unstable without partner subunits

    • Co-expression of multiple subunits may be necessary

    • Design of stabilizing mutations or fusion partners may be required

  • G+C content adaptation:

    • The low G+C content of P. marinus SS120 (36.4%) differs from P. pastoris

    • This may necessitate more extensive codon optimization

    • Consider designing synthetic genes rather than direct cloning

These challenges can be addressed through careful experimental design and optimization strategies tailored to the specific properties of ATP synthase subunit b.

How can I overcome potential interspecies incompatibility between Prochlorococcus components and Pichia expression machinery?

Addressing interspecies incompatibility requires multilevel intervention strategies:

  • Genetic optimization approaches:

    • Codon optimization beyond basic usage preferences, considering mRNA secondary structure

    • Removal of cryptic splice sites that might be recognized by the P. pastoris spliceosome

    • Elimination of internal Shine-Dalgarno-like sequences that might cause translational pausing

  • Expression enhancement strategies:

    • Co-expression of cyanobacterial chaperones to assist folding

    • Fusion to solubility-enhancing partners that can be later removed

    • Testing of various promoter strengths to find optimal expression levels

  • Membrane targeting optimization:

    • Testing different signal sequences beyond the standard α-factor

    • Creation of signal sequence libraries to identify optimal targeting

    • Engineering of the transmembrane domains to improve insertion efficiency

  • Host adaptation approaches:

    • Use of specialized P. pastoris strains with altered membrane composition

    • Engineering P. pastoris to produce cyanobacterial-specific lipids

    • Development of strains with reduced proteolytic activity

The methodology used for expressing Pro1404 from P. marinus SS120 in Synechococcus elongatus, where the gene was placed downstream of different kanamycin resistance cassettes with promoters of varying strengths (C.K1 for moderate and C.K3 for strong expression), provides a useful template for exploring expression optimization strategies .

What are the most informative methods for analyzing ATP synthase function in recombinant systems?

MethodParameter MeasuredAdvantagesLimitations
ATP synthesis assayATP production rateDirect measure of functionRequires intact complexes
ATP hydrolysis assayPi release rateWorks with partial complexesMay not reflect in vivo activity
Proton translocationΔpH across membraneMeasures core F₀ functionTechnical complexity
Membrane potentialΔψ using fluorescent probesNon-invasive, real-timeIndirect measure
Super-resolution TMRM imagingSpatial variation in potentialCan detect heterogeneity within single organelles Specialized equipment required
Blue native PAGEComplex assemblyPreserves native interactionsSemi-quantitative
Cryo-EMStructural integrityHigh-resolution structural dataSample preparation challenges

When analyzing recombinant ATP synthase components, it's important to combine multiple methods to build a comprehensive understanding of both structural integrity and functional capacity. The choice of methods should be guided by specific research questions and available resources.

How do I troubleshoot low expression yields of ATP synthase subunit b in P. pastoris?

Systematic troubleshooting of low expression yields:

  • Transcriptional level analysis:

    • Quantify mRNA levels using RT-qPCR

    • Check for premature transcription termination

    • Evaluate promoter functionality in your specific construct

  • Translational efficiency assessment:

    • Perform polysome profiling to check for translation initiation issues

    • Consider redesigning the 5' UTR for improved ribosome binding

    • Evaluate rare codon usage patterns that might cause ribosomal stalling

  • Protein stability evaluation:

    • Add protease inhibitors during extraction

    • Test lower growth temperatures to slow folding

    • Evaluate different lysis conditions to preserve protein integrity

  • Expression strain optimization:

    • Test protease-deficient P. pastoris strains

    • Evaluate strains with different auxotrophies

    • Consider specialized strains engineered for membrane protein expression

  • Growth condition modification:

    • Optimize media composition (carbon source, nitrogen, trace elements)

    • Test various induction strategies if using inducible promoters

    • Evaluate the effect of growth phase on expression levels

The techniques used to express the Pro1404 gene in Synechococcus elongatus, where different promoter strengths were tested and transcriptional terminators were carefully positioned, can provide guidance for expression optimization .

How can I distinguish between ATP synthesis and hydrolysis activities in recombinant ATP synthase preparations?

Distinguishing between synthesis and hydrolysis activities requires specialized experimental approaches:

  • Differential inhibition analysis:

    • Use (+)-epicatechin (EPI) which selectively inhibits ATP hydrolysis without affecting synthesis

    • Apply oligomycin under conditions where it selectively affects either synthesis or hydrolysis

    • Test pH-dependent inhibitors that exploit the different pH optima of the two reactions

  • Directional assay design:

    • Establish opposing proton gradients to drive activity preferentially in one direction

    • Use caged substrates with light activation to initiate reactions from defined starting points

    • Develop real-time assays with directional indicators

  • Genetic modifications for functional bias:

    • Introduce mutations known to affect directionality

    • Express regulators like ATPIF1 which inhibits hydrolysis under specific conditions

    • Create chimeric constructs with enhanced directional specificity

  • Physiological condition manipulation:

    • Vary ATP/ADP ratios to favor one direction

    • Manipulate proton gradient magnitude and direction

    • Control redox state to influence enzyme conformation

  • In situ analysis techniques:

    • Super-resolution microscopy with potential-sensitive probes like TMRM

    • Real-time ATP sensing using genetically encoded biosensors

    • Simultaneous monitoring of membrane potential and ATP levels

These approaches can help researchers accurately characterize the complex bidirectional behavior of ATP synthase in experimental systems.

How might studying Prochlorococcus ATP synthase inform bioenergetic adaptations to extreme environments?

Prochlorococcus marinus has evolved to thrive in nutrient-poor oceanic environments with varying light conditions. Its ATP synthase likely reflects adaptations to maximize energy efficiency under these constraints. Future research directions include:

  • Comparative bioenergetic studies:

    • Analysis of ATP synthase efficiency across different Prochlorococcus ecotypes (high-light vs. low-light adapted strains)

    • Comparison with ATP synthases from diverse photosynthetic organisms

    • Investigation of regulatory mechanisms that may be unique to oligotrophic specialists

  • Structural adaptations investigation:

    • Detailed structural analysis of P. marinus ATP synthase to identify unique features

    • Examination of subunit stoichiometry and interactions under various environmental conditions

    • Investigation of potential structural modifications that enhance function under low energy input

  • Energy conservation mechanisms:

    • Exploration of how Prochlorococcus manages the balance between ATP synthesis and hydrolysis

    • Investigation of potential ATP synthase regulators similar to ATPIF1 that may be present in Prochlorococcus

    • Analysis of potential cross-talk between photosynthetic electron transport and ATP synthase regulation

The minimal genome of P. marinus SS120 (1.75 Mb) suggests strong selection pressure for retaining only essential functions, making its ATP synthase particularly interesting for understanding fundamental bioenergetic requirements.

What insights can multiphase transport kinetics provide for optimizing recombinant protein studies?

The discovery that the Pro1404 glucose transporter from Prochlorococcus exhibits multiphasic transport kinetics with a high-affinity phase in the nanomolar range suggests important considerations for other recombinant protein studies:

  • Concentration-dependent behavior analysis:

    • Test protein function across wide concentration ranges (nano- to millimolar)

    • Develop assays capable of detecting activity at environmentally relevant concentrations

    • Investigate potential allosteric regulation mechanisms that drive multiphasic kinetics

  • Physiological relevance assessment:

    • Evaluate whether laboratory conditions reflect natural environmental concentrations

    • Consider how protein behavior changes across concentration gradients

    • Investigate whether multiphasic kinetics represent an adaptation to variable environmental conditions

  • Methodological implications:

    • Develop more sensitive assays for detecting activity at extremely low substrate concentrations

    • Design experiments to capture complete kinetic profiles rather than standard Michaelis-Menten parameters

    • Consider how expression system choice might affect kinetic properties of recombinant proteins

  • Structural dynamics investigation:

    • Explore potential conformational changes associated with different kinetic phases

    • Investigate oligomerization states that might explain multiphasic behavior

    • Examine potential post-translational modifications that could influence kinetics

These insights from transport proteins like Pro1404 may have broader implications for studying ATP synthase components, particularly regarding concentration-dependent assembly and functional properties.

How might research on cyanobacterial ATP synthase inform development of bioenergetic interventions for disease?

Recent research on the dual function of ATP synthase has revealed potential therapeutic approaches for mitochondrial diseases . This has parallels for research on cyanobacterial ATP synthase:

  • Inhibitor development strategies:

    • Screen for compounds that selectively inhibit ATP hydrolysis without affecting synthesis, similar to (+)-epicatechin

    • Investigate natural products from marine environments that might modulate cyanobacterial ATP synthase

    • Develop structure-guided design of directionally selective inhibitors

  • Regulatory mechanism exploration:

    • Investigate whether cyanobacteria possess ATPIF1-like regulatory proteins

    • Explore potential for engineering regulatory elements from cyanobacteria into eukaryotic systems

    • Study how photosynthetic organisms balance ATP synthesis/hydrolysis during light/dark transitions

  • Bioenergetic intervention applications:

    • Explore potential for targeting ATP synthase in photosynthetic pathogens

    • Investigate applications in controlling harmful algal blooms

    • Develop biotechnological applications for enhanced biofuel production

  • Evolutionary insights:

    • Compare regulatory mechanisms across evolutionary lineages

    • Investigate how endosymbiosis events influenced ATP synthase regulation

    • Explore potential for hybrid systems combining features from different organisms

The research by Acin-Perez et al. (2023) showing that selective inhibition of ATP hydrolysis with (+)-epicatechin improved outcomes in disease models suggests parallel approaches might be beneficial in various research contexts.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.