Recombinant Prochlorococcus marinus subsp. pastoris Cytochrome b6-f complex iron-sulfur subunit (petC)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted as needed.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If a specific tag type is required, please inform us, and we will prioritize its use.
Synonyms
petC; PMM0462; Cytochrome b6-f complex iron-sulfur subunit; Plastohydroquinone:plastocyanin oxidoreductase iron-sulfur protein; ISP; RISP; Rieske iron-sulfur protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-178
Protein Length
full length protein
Species
Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / NIES-2087 / MED4)
Target Names
petC
Target Protein Sequence
MTQLSSNDVPSMGRRQFMNLLTFGTATGVALGALYPVANYFMPLRAGGGGGGTSAKDELG NPVTKTGWLASHQAGDRSLVQGLKGDPTYLIVNSEGEIGEFGLNAICTHLGCVVPWDSGA NKFICPCHGSQYDTNGKVVRGPAPLSLALAHVDVDDDAVLVKQWSETDFRTNENPWWA
Uniprot No.

Target Background

Function

A component of the cytochrome b6-f complex, this protein mediates electron transfer between photosystem II (PSII) and photosystem I (PSI), cyclic electron flow around PSI, and state transitions.

Database Links

KEGG: pmm:PMM0462

STRING: 59919.PMM0462

Subcellular Location
Cellular thylakoid membrane; Single-pass membrane protein.

Q&A

What is the Cytochrome b6-f complex and what role does PetC play in it?

The Cytochrome b6-f complex (plastoquinol/plastocyanin oxidoreductase; EC 7.1.1.6) is a crucial enzyme found in the thylakoid membrane of chloroplasts in plants, cyanobacteria, and green algae. It catalyzes the transfer of electrons from plastoquinol to plastocyanin according to the reaction:

plastoquinol + 2 oxidized plastocyanin + 2 H+[side 1] → plastoquinone + 2 reduced plastocyanin + 4 H+[side 2]

Within this complex, PetC (also known as the Rieske iron-sulfur protein) serves as one of the four large subunits. It contains a high-potential [2Fe-2S] cluster that plays a critical role in electron transfer during photosynthesis . PetC is essential for maintaining the structure and function of the cytochrome b6-f complex, which acts as a crucial link in the electron transport chain between Photosystem II and Photosystem I while simultaneously pumping protons into the thylakoid space to generate the electrochemical gradient used for ATP synthesis .

What is the structure and molecular characteristics of PetC in Prochlorococcus marinus subsp. pastoris?

The PetC protein in Prochlorococcus marinus subsp. pastoris (formerly classified as P. marinus strain PCC 9511) is a 19 kDa Rieske iron-sulfur protein containing a [2Fe-2S] cluster . The protein contains one Rieske domain characterized by specific conserved motifs necessary for iron-sulfur cluster binding. The structural architecture includes:

  • Molecular weight: Approximately 19-21 kDa

  • Iron-sulfur cluster: One [2Fe-2S] cluster with characteristic Rieske-type coordination

  • Cellular location: Anchored in the thylakoid membrane with a soluble domain extending into the lumen

  • Conserved motifs: Includes the characteristic amino acid motifs (Arg-His-Arg-Tyr, Leu-Leu-Gly-His, and Gly-Thr) that are essential for function

The structural configuration of PetC facilitates its crucial role in the electron transport process between the quinol oxidation site and the luminal electron carriers.

How is Prochlorococcus marinus subsp. pastoris taxonomically classified and what makes it significant?

Recent genomic taxonomy research has significantly revised our understanding of Prochlorococcus classification. The Prochlorococcus collective, once thought to be a single genus comprising one species (Prochlorococcus marinus) with multiple ecotypes, has now been reclassified into five distinct genera: Prochlorococcus, Eurycolium, Prolificoccus, Thaumococcus, and Riococcus .

Within this new taxonomy, P. marinus subsp. pastoris represents a specific strain that belongs to the high-light adapted (HL) ecotype group. This strain is particularly significant because:

  • It is among the most abundant photosynthetic prokaryotes on Earth

  • It has evolved specialized adaptations for thriving in the nutrient-poor oceanic environment

  • It utilizes a unique divinyl chlorophyll a/b light-harvesting complex

  • It cannot utilize nitrate but has a strong preference for ammonium as a nitrogen source

  • It synthesizes one of the smallest known ureases, which helps in nitrogen metabolism

The taxonomic revision has important implications for ecological and evolutionary studies on these organisms, as they represent distinct genomic and ecological entities rather than mere ecotypes of a single species .

How does the Cytochrome b6f complex in Prochlorococcus differ from the mitochondrial Cytochrome bc1 complex?

While the Cytochrome b6f complex shares functional similarities with the mitochondrial Cytochrome bc1 complex (Complex III), several key structural and functional differences exist:

FeatureCytochrome b6f ComplexCytochrome bc1 Complex
Cellular locationThylakoid membrane in cyanobacteria, chloroplastsInner mitochondrial membrane
Core structureFour large subunits: cytochrome f, cytochrome b6, Rieske iron-sulfur protein (PetC), and subunit IVThree core subunits: cytochrome b, cytochrome c1, and Rieske iron-sulfur protein
Additional cofactorsContains chlorophyll a and β-caroteneNo chlorophyll or carotenoid pigments
Unique hemeContains an additional heme cn not found in bc1No equivalent heme
Quinone reduction mechanismDifferent from bc1, lacks quinone intermediateForms ubiquinol intermediate (UQ-)
Inhibitor sensitivityNot inhibited by antimycin ASpecifically inhibited by antimycin A
EvolutionCytochrome f and cytochrome c1 are not related but represent convergent evolutionDifferent evolutionary origin

These differences highlight the unique adaptations of the Cytochrome b6f complex in photosynthetic organisms like Prochlorococcus compared to the respiratory complex in mitochondria .

What standard methods are used to isolate and characterize the PetC protein?

Standard methods for isolating and characterizing PetC from Prochlorococcus marinus subsp. pastoris typically follow these protocols:

Isolation procedure:

  • Culture growth: Cells are grown at 18-20°C in liquid medium PCR-Tu under appropriate light conditions

  • Cell harvesting: Centrifugation at 10,000 × g for 10 minutes

  • Cell disruption: Sonication or French press in buffer containing detergents

  • Membrane isolation: Differential centrifugation to isolate thylakoid membranes

  • Solubilization: Membrane proteins are solubilized using mild detergents (e.g., n-dodecyl-β-D-maltoside)

  • Chromatography: Sequential purification using ion exchange and size exclusion chromatography

Characterization methods:

  • SDS-PAGE analysis to confirm molecular weight

  • Western blotting with anti-Rieske protein antibodies

  • UV-visible spectroscopy to assess iron-sulfur cluster integrity

  • EPR spectroscopy to characterize the electronic properties of the [2Fe-2S] cluster

  • Activity assays measuring electron transfer rates from plastoquinol to plastocyanin

These techniques provide essential information about the structural and functional properties of the isolated PetC protein .

What experimental approaches are optimal for expressing and purifying recombinant PetC from Prochlorococcus marinus subsp. pastoris?

Expressing and purifying recombinant PetC from Prochlorococcus requires careful consideration of the unique properties of this cyanobacterial protein. The following methodological approach has proven effective:

Expression system selection:

  • E. coli-based expression systems using BL21(DE3) or Rosetta strains are preferred

  • Expression vectors containing T7 promoters and optional fusion tags (His6, MBP, or SUMO) facilitate purification

  • Co-expression with iron-sulfur cluster biogenesis proteins (isc or suf operons) enhances proper folding

Optimization protocol:

  • Clone the petC gene with codon optimization for the expression host

  • Transform into an appropriate E. coli strain supplemented with plasmids encoding iron-sulfur cluster assembly machinery

  • Culture growth at lower temperatures (16-20°C) after induction reduces inclusion body formation

  • Supplement growth medium with iron source (ferric ammonium citrate, 50-100 μM) and sulfur (cysteine or sodium sulfide)

  • Induce expression with lower IPTG concentrations (0.1-0.5 mM) for longer periods (16-24 hours)

Purification strategy:

  • Cell lysis under anaerobic or micro-aerobic conditions preserves iron-sulfur cluster integrity

  • Include reducing agents (2-5 mM DTT or β-mercaptoethanol) in all buffers

  • Implement a two-step purification using affinity chromatography followed by size exclusion chromatography

  • Verify successful expression and folding by monitoring the characteristic absorbance of the [2Fe-2S] cluster (peak at ~460nm)

  • Conduct reconstitution of the iron-sulfur cluster in vitro if necessary

This comprehensive approach addresses the challenges associated with expressing iron-sulfur proteins while maintaining their functionality for subsequent biochemical and structural studies .

How does the genomic diversity within the Prochlorococcus collective impact the structure and function of PetC?

The recent genomic taxonomy revision of the Prochlorococcus collective into five distinct genera (Prochlorococcus, Eurycolium, Prolificoccus, Thaumococcus, and Riococcus) has profound implications for understanding PetC diversity . This genomic diversity manifests in several ways:

Genetic variation in petC genes:

  • Sequence variations in the petC coding regions across different Prochlorococcus genera reflect adaptations to specific ecological niches

  • Genomic analysis reveals that unlike other photosynthetic complex subunits encoded by single genes, some cyanobacteria contain multiple petC genes (as observed in Synechocystis PCC 6803 with three petC genes)

  • The distribution of these gene variants correlates with light adaptation strategies (high-light vs. low-light adapted ecotypes)

Functional implications:

  • Different PetC variants demonstrate distinct biophysical properties, including redox potentials and electron transfer kinetics

  • In some cyanobacteria, multiple PetC isoforms (PetC1, PetC2, PetC3) serve different physiological functions, with PetC1 typically being the dominant form

  • The presence of multiple isoforms provides functional redundancy, as demonstrated by knockout studies showing that deletion of individual petC genes (but not combinations of petC1 and petC2) is tolerated

Evolutionary context:

  • The estimated pan-genome of the Prochlorococcus collective includes over 80,000 genes

  • Horizontal gene transfer contributes to the genomic plasticity within these genera, potentially affecting electron transport components

  • Distributed genome hypothesis explains the observed diversity pattern, where individual strains possess only a portion of the collective gene repertoire

This genomic diversity directly impacts recombinant PetC production strategies, as researchers must carefully select the appropriate gene variant based on the specific research questions being addressed .

What are the challenges in designing experiments to study the electron transfer kinetics of recombinant PetC?

Investigating electron transfer kinetics of recombinant PetC presents several methodological challenges that require careful experimental design:

Technical challenges:

  • Maintaining iron-sulfur cluster integrity during purification and analysis

  • Achieving correct redox partner interactions in reconstituted systems

  • Developing suitable in vitro assays that accurately reflect in vivo conditions

  • Controlling experimental variables that affect electron transfer rates

Methodological solutions:

  • Sample preparation considerations:

    • Purify proteins under anaerobic conditions to prevent cluster oxidation

    • Verify cluster integrity through spectroscopic methods (UV-vis, EPR) before kinetic measurements

    • Use physiologically relevant buffer conditions (pH, ionic strength) for kinetic assays

  • Kinetic measurement techniques:

    • Stopped-flow spectroscopy with millisecond time resolution

    • Laser flash photolysis for faster reactions (microsecond to nanosecond)

    • Electrochemical methods (cyclic voltammetry, protein film voltammetry)

    • Temperature-dependent measurements to determine activation parameters

  • Data analysis approaches:

    • Apply appropriate kinetic models (single-exponential vs. multi-exponential decay)

    • Use global analysis methods for complex reaction schemes

    • Consider computational modeling to interpret experimental results

  • Validation strategies:

    • Compare results from multiple independent techniques

    • Perform site-directed mutagenesis to probe specific residues involved in electron transfer

    • Correlate in vitro measurements with in vivo functionality

By addressing these challenges systematically, researchers can obtain reliable kinetic data that provides insights into the electron transfer mechanisms of recombinant PetC within the context of the cytochrome b6f complex .

How can adaptive-optimal design principles be applied to experiments involving recombinant PetC?

Adaptive-optimal experimental design can significantly enhance the efficiency and information yield of experiments involving recombinant PetC. This approach is particularly valuable given the complexity of working with membrane-associated iron-sulfur proteins .

Implementation strategy:

This approach has been successfully applied in related fields, such as PET occupancy studies, where it minimized the number of subjects required while maximizing information content .

What are the implications of multiple PetC isoforms for understanding photosynthetic electron transfer in marine cyanobacteria?

Research on cyanobacterial systems has revealed that unlike other photosynthetic complex subunits, some cyanobacteria contain multiple petC genes encoding different Rieske iron-sulfur protein isoforms, which has significant implications for understanding electron transfer in these organisms .

Discovered functional diversity:

  • In Synechocystis PCC 6803, three petC genes (petC1, petC2, petC3) encode distinct Rieske protein isoforms

  • PetC1 serves as the dominant isoform in the cytochrome b6f complex

  • PetC2 can partially substitute for PetC1 function, providing redundancy

  • PetC3 appears to have a specialized physiological role and cannot functionally replace the other isoforms

Research findings on isoform functionality:

  • Deletion studies: Individual petC genes can be deleted without dramatically altering phenotype, but double deletion of petC1 and petC2 is not viable

  • Electron transfer characteristics: Different isoforms exhibit distinct electron transfer properties:

    • PetC3 may interact with alternative electron donors with lower redox potentials than plastoquinol

    • The isoforms likely evolved to optimize electron flow under different environmental conditions

Application to Prochlorococcus research:

  • Given the genomic diversity within the Prochlorococcus collective (now split into five genera), variation in PetC isoforms likely contributes to their adaptation to different oceanic niches

  • The eco-genomic diversity of Prochlorococcus suggests specialized adaptations of the electron transport chain components

  • When working with recombinant PetC, researchers must consider which isoform is most relevant to their specific research question

Methodological implications:

  • Sequence analysis should be performed to identify potential isoforms before initiating recombinant expression

  • Expression studies should compare the properties of different isoforms when present

  • Functional assays should evaluate potential differences in electron transfer capabilities

  • Ecological context should be considered when interpreting results

This diversity in PetC isoforms represents an important aspect of photosynthetic adaptation in marine cyanobacteria and highlights the need for careful isoform selection in recombinant studies .

How does horizontal gene transfer affect PetC evolution and function in the Prochlorococcus collective?

Horizontal gene transfer (HGT) has played a significant role in shaping the genomic landscape of the Prochlorococcus collective, with important implications for PetC evolution and function .

Evidence for HGT in Prochlorococcus:

  • The Prochlorococcus collective is thought to exhibit high degrees of panmixis due to horizontal gene transfer

  • Phage-mediated gene transfer has been documented, with cyanophages carrying core photosynthetic genes

  • The pangenome of the Prochlorococcus collective is estimated to include over 80,000 genes, far exceeding what any single strain contains

HGT mechanisms relevant to PetC:

  • Phage-mediated transfer:

    • Cyanophages infecting Prochlorococcus have been shown to carry photosynthetic genes

    • These phages can facilitate gene transfer between different Prochlorococcus strains

    • The presence of a phage-related integrase gene in some Prochlorococcus strains suggests a mechanism for integration of foreign DNA

  • Natural competence and transformation:

    • Stress-induced competence allows cells to take up DNA from the environment

    • Multiple gene transfer events can occur in a single competence event

    • This process acts as a "mutation-on-demand" mechanism allowing adaptation to environmental stressors

Implications for PetC research:

  • Researchers must consider the evolutionary history of petC genes when designing recombinant studies

  • Sequence analysis should include examination of flanking regions for evidence of HGT

  • Expression systems may need to account for codon usage patterns that reflect the gene's evolutionary history

  • Functional differences between PetC variants may reflect adaptations acquired through HGT events

Experimental approaches to investigate HGT:

  • Comparative genomic analysis of petC loci across Prochlorococcus strains

  • Phylogenetic analysis to identify incongruencies suggesting HGT

  • Codon usage analysis to detect recently transferred genes

  • Functional characterization of PetC variants from different genomic backgrounds

Understanding these evolutionary processes provides critical context for interpreting functional differences in recombinant PetC studies and helps explain the remarkable ecological success of the Prochlorococcus collective .

What are the best approaches for analyzing the integration of recombinant PetC into functional Cytochrome b6f complexes?

Assessing the integration and functionality of recombinant PetC in Cytochrome b6f complexes requires a multifaceted approach that combines structural, biochemical, and functional analyses:

Structural integration assessment:

  • Blue-native PAGE analysis:

    • Separates intact protein complexes while preserving native structure

    • Can identify assembled vs. unassembled complexes

    • Western blotting with anti-PetC antibodies confirms incorporation

  • Co-immunoprecipitation assays:

    • Using antibodies against other complex subunits to pull down intact complexes

    • Western blotting to detect co-precipitated recombinant PetC

    • Requires careful optimization of detergent conditions

  • Microscopy techniques:

    • Fluorescently-tagged PetC variants for localization studies

    • Single-particle cryo-electron microscopy to visualize complex architecture

    • FRET-based approaches to analyze proximity to other complex components

Functional integration assessment:

  • Electron transfer activity measurements:

    • Spectrophotometric assays monitoring plastoquinol oxidation and plastocyanin reduction

    • Flash-induced absorbance changes to measure electron transfer kinetics

    • Comparison with native complex activities

  • Redox titrations:

    • Potentiometric titrations to determine midpoint potentials

    • EPR spectroscopy to monitor [2Fe-2S] cluster redox state

    • Comparison with native PetC redox properties

  • Complementation experiments:

    • Expression in cyanobacterial mutants lacking functional PetC

    • Assessment of photosynthetic growth recovery

    • Measurement of photosynthetic electron transport rates in vivo

Data analysis framework:

Analysis LevelTechniquesOutcomesInterpretation
Primary structureMass spectrometry, sequence verificationConfirm protein integrityValidates starting material
Secondary/tertiary structureCD spectroscopy, thermal stabilityProper folding, stabilityIndicates correct protein conformation
Quaternary structureBN-PAGE, size exclusion chromatographyComplex assemblyConfirms integration into b6f complex
Functional analysisActivity assays, electrochemistryElectron transfer ratesDemonstrates functional integration
In vivo validationGenetic complementation, growth ratesPhysiological functionProves biological relevance

This comprehensive analytical framework allows researchers to conclusively determine whether recombinant PetC successfully integrates into functional Cytochrome b6f complexes and maintains its native electron transfer capabilities .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.