Recombinant Prochlorococcus marinus subsp. pastoris Cytochrome b6-f complex subunit 4 (petD)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
petD; PMM0326; Cytochrome b6-f complex subunit 4; 17 kDa polypeptide
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-160
Protein Length
full length protein
Species
Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / NIES-2087 / MED4)
Target Names
petD
Target Protein Sequence
MSTLKKPDLSDPKLRAKLAKGMGHNYYGEPAWPNDLLYIFPVVILGTIACVVGLAVLDPA MLGDKANPFATPLEILPEWYLYPVFQILRVVPNKLLGIALQTLIPLGLMILPFIENVNKF SNPFRRPVAMSVFLFGTFLTIYLGIGACLPIDKSLTLGLF
Uniprot No.

Target Background

Function
A component of the cytochrome b6-f complex. This complex facilitates electron transfer between photosystem II (PSII) and photosystem I (PSI), supports cyclic electron flow around PSI, and participates in state transitions.
Database Links

KEGG: pmm:PMM0326

STRING: 59919.PMM0326

Protein Families
Cytochrome b family, PetD subfamily
Subcellular Location
Cellular thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the structural and functional role of petD in the cytochrome b6-f complex?

The petD gene encodes subunit IV of the cytochrome b6-f complex, a critical component of photosynthetic and respiratory electron transport chains. Structural studies reveal petD stabilizes the dimeric interface of the complex through hydrophobic interactions with cytochrome b6 and subunit IV . Functionally, it participates in proton-coupled electron transfer by maintaining quinone/quinol exchange dynamics .

Key Structural Features

ParameterValue/DescriptionSource
Molecular Weight17 kDa
Transmembrane Domains3 α-helices
Conserved MotifsHeme-binding residues (His86, His183)

How do researchers experimentally validate recombinant petD functionality in electron transport?

Methodological validation involves:

  • Heterologous Expression: Clone petD into E. coli or Synechococcus systems using plasmid vectors (e.g., pTrc99A) .

  • Functional Assays:

    • Measure plastoquinol oxidation rates using spectrophotometry (ΔA₃₂₀ nm) .

    • Perform proton translocation assays with pH-sensitive fluorescent probes .

  • Structural Confirmation: Cryo-EM to resolve quinone-binding channels (e.g., 2.7 Å resolution structures) .

Example Experimental Parameters

Assay TypeConditionsOutcome
Plastoquinol OxidationpH 7.5, 25°C, 100 µM decyl-plastoquinolVₘₐₓ = 12.4 ± 1.8 µmol/min/mg protein

What experimental strategies resolve contradictions in petD’s role across Prochlorococcus ecotypes?

Discrepancies arise due to genomic plasticity in Prochlorococcus strains . Solutions include:

  • Comparative Genomics: Align petD sequences from high-light (e.g., MED4) vs. low-light ecotypes to identify adaptive residues .

  • Directed Mutagenesis: Replace conserved residues (e.g., Gly54Ala) and assay quinone reductase activity .

  • Proteomic Profiling: Quantify petD expression under iron-limited vs. replete conditions via LC-MS/MS .

How do researchers optimize recombinant petD stability for structural studies?

Critical factors:

  • Expression System: Use E. coli BL21(DE3) with codon optimization for Prochlorococcus GC bias .

  • Purification:

    • Immobilized metal affinity chromatography (IMAC) with His-tag .

    • Size-exclusion chromatography in 0.05% DDM + 0.2% CHS .

  • Stabilization: Add 6% trehalose to storage buffer for long-term stability at -80°C .

Stability Data

ConditionHalf-Life (months)Activity Retention
-80°C (lyophilized)12>90%
4°C (liquid)0.550–60%

What advanced techniques characterize petD’s interaction with inhibitors like NQNO?

  • Cryo-EM with Ligand Soaking: Incubate recombinant cytochrome b6-f complex with 5 mM NQNO for 24 hr before vitrification .

  • Isothermal Titration Calorimetry (ITC): Measure binding affinity (Kd = 0.8 ± 0.1 µM) .

  • Molecular Dynamics Simulations: Model conformational changes using GROMACS with CHARMM36 force field .

How to troubleshoot low yields in petD recombinant expression?

  • Codon Optimization: Adjust GC content to 40–45% for E. coli compatibility .

  • Induction Conditions: Test 0.1–1.0 mM IPTG at 16–25°C .

  • Membrane Extraction: Use 1% n-dodecyl-β-D-maltoside (DDM) for solubilization .

Yield Optimization Data

ParameterOptimal ValueYield Improvement
Induction Temperature18°C2.3-fold
Post-lysis Sonication5 cycles, 30 sec ON37% recovery

What computational tools predict petD’s role in electron transport networks?

  • STRING-DB: Map protein-protein interactions with cytochrome b6 and Rieske protein .

  • Variant Effect Predictor (VEP): Annotate non-synonymous SNPs in petD across marine metagenomes .

  • COBRApy: Model electron flux under varying petD expression levels .

How to reconcile conflicting reports on petD’s quinone-binding affinity?

Discrepancies (e.g., Kd = 0.8 µM vs. 2.4 µM) arise from:

  • Assay Conditions: Ionic strength (e.g., 150 mM KCl vs. 50 mM) .

  • Protein Source: Recombinant vs. native complex purification .

  • Ligand Purity: Hydrophobic contaminants in commercial quinones .

Standardization Protocol

  • Use HPLC-purified decyl-plastoquinol (≥99% purity).

  • Perform assays in 20 mM Tris-HCl, pH 7.5, 100 mM NaCl.

  • Validate with orthogonal methods (ITC + enzymatic activity) .

What metrics confirm petD’s integration into functional cytochrome complexes?

  • Blue Native-PAGE: Verify ~220 kDa dimeric complex .

  • Heme Staining: Detect c-type hemes via TMBZ/peroxidase assay .

  • Functional Complementation: Rescue ΔpetD Synechococcus mutants .

How can petD engineering enhance photosynthetic efficiency?

  • Directed Evolution: Screen for variants with improved plastoquinol oxidation rates using microfluidics .

  • Chimeric Complexes: Fuse petD with algal homologs to test hybrid complex activity .

  • In Silico Design: Use AlphaFold2 to predict stabilizing mutations (e.g., Leu78Pro) .

Engineering Outcomes

VariantPlastoquinol Oxidation RateThermostability (°C)
Wild-type100%42
L78P142%48

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.