Recombinant Prochlorococcus marinus subsp. pastoris Glycerol-3-phosphate acyltransferase (plsY)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order. We will accommodate your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery times, please consult your local distributors.
Note: All protein shipments are standardly packaged with blue ice packs. If you require dry ice, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For working aliquots, store at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50% and can be used as a reference.
Shelf Life
Shelf life is influenced by several factors including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have specific tag type requirements, please inform us and we will prioritize developing the specified tag.
Synonyms
plsY; PMM1327; Glycerol-3-phosphate acyltransferase; Acyl-PO4 G3P acyltransferase; Acyl-phosphate--glycerol-3-phosphate acyltransferase; G3P acyltransferase; GPAT; Lysophosphatidic acid synthase; LPA synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-198
Protein Length
full length protein
Species
Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / NIES-2087 / MED4)
Target Names
plsY
Target Protein Sequence
MHILIISISYFLGSLPTGFLFGKFLKNIDLRLTGSGSTGATNVLRNVGKWPAFFVFIIDV GKGLIAVKIAQHYTNQNLFEVLAGIAAISGHIWPIWLKGKGGKAVATGLGMFIALSWKIG FASLGIFLIILAKSKIVSLSSISAAIFLPFLMFLDIGSTNHPYFFISLVVSILVIWKHRT NIRRLLKGEELKINDINK
Uniprot No.

Target Background

Function
This enzyme catalyzes the transfer of an acyl group from acyl-phosphate (acyl-PO(4)) to glycerol-3-phosphate (G3P), resulting in the formation of lysophosphatidic acid (LPA). It utilizes acyl-phosphate as the fatty acyl donor, but not acyl-CoA or acyl-ACP.
Database Links

KEGG: pmm:PMM1327

STRING: 59919.PMM1327

Protein Families
PlsY family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Glycerol-3-phosphate acyltransferase (plsY) and what is its role in Prochlorococcus marinus?

Glycerol-3-phosphate acyltransferase (plsY) is a membrane-associated enzyme that catalyzes a critical step in phospholipid biosynthesis. In Prochlorococcus marinus, this enzyme transfers an acyl group from acyl-phosphate to the sn-1 position of glycerol-3-phosphate, forming lysophosphatidic acid. This reaction represents the first committed step in the biosynthesis of membrane phospholipids, making plsY essential for membrane formation and cellular viability in this marine cyanobacterium.

The full-length protein consists of 206 amino acids and plays a crucial role in the adaptation of Prochlorococcus marinus to its marine environment through regulation of membrane lipid composition .

How is recombinant plsY from Prochlorococcus marinus typically expressed and purified?

Recombinant Prochlorococcus marinus plsY is typically expressed in E. coli expression systems. According to available information, the full-length protein (comprising amino acids 1-206) can be successfully produced with an N-terminal His-tag to facilitate purification . This expression system offers several advantages:

  • High yield production of soluble protein

  • Well-established induction protocols

  • Compatibility with standard purification techniques

  • Ability to scale production for extensive experimental work

The purification typically follows these methodological steps:

  • Cell lysis under optimized buffer conditions

  • Immobilized metal affinity chromatography (IMAC) using the N-terminal His-tag

  • Size exclusion chromatography for increased purity

  • Analysis of purity using SDS-PAGE and Western blotting

What are the optimal storage conditions for maintaining plsY enzyme activity?

Maintaining plsY enzyme activity requires careful attention to storage conditions. Based on experimental design principles for enzyme studies, the following methodology is recommended:

  • Store purified enzyme at -80°C in storage buffer containing 20-25% glycerol

  • Add reducing agents (1-5 mM DTT or β-mercaptoethanol) to prevent oxidation of cysteine residues

  • Include protease inhibitors to prevent degradation

  • Aliquot the protein solution to avoid repeated freeze-thaw cycles

  • Consider flash-freezing in liquid nitrogen before storage

Monitoring activity retention over time under different storage conditions using systematic experimental design allows researchers to determine optimal conditions specific to this enzyme .

How should researchers design experiments to study plsY enzymatic activity?

When designing experiments to study plsY enzymatic activity, researchers should implement rigorous experimental design principles including:

  • Clear definition of variables:

    • Independent variables: Factors manipulated in the experiment (e.g., substrate concentration, pH, temperature)

    • Dependent variables: Measured outcomes (e.g., enzyme reaction rate, product formation)

    • Control variables: Factors held constant across conditions

  • Systematic controls:

    • Positive controls (known active enzyme preparations)

    • Negative controls (heat-inactivated enzyme, no enzyme controls)

    • Vehicle controls when using inhibitors or activators

  • Variable optimization:

    • Temperature ranges that reflect physiological conditions for marine organisms

    • pH ranges that mirror intracellular conditions

    • Substrate concentration series for kinetic analyses

Variable TypeExamples for plsY Activity AssaysControl Methodology
Independent VariablesSubstrate concentrations, pH values, temperaturesSystematically vary one while controlling others
Dependent VariablesRate of acyl transfer, product formationStandardized detection methods (e.g., spectrophotometric, HPLC)
Control VariablesBuffer composition, ionic strength, enzyme concentrationRigorous preparation protocols with quality control steps
Confounding VariablesProtein stability, substrate degradationStability assessments, freshly prepared reagents

By applying these structured experimental design principles, researchers can generate reliable and reproducible data on plsY activity .

What methodological approaches are recommended for studying plsY substrate specificity?

To rigorously investigate plsY substrate specificity, a multi-faceted methodological approach is recommended:

  • Enzyme kinetics analysis:

    • Determine Km and Vmax for various acyl-phosphate donors

    • Calculate catalytic efficiency (kcat/Km) for different substrates

    • Perform competitive assays with multiple substrates

  • Structure-function analysis:

    • Site-directed mutagenesis of predicted binding site residues

    • Analysis of substrate binding using biophysical techniques

    • Molecular modeling and docking simulations

  • Comparative biochemistry:

    • Parallel analysis of plsY from different Prochlorococcus strains

    • Comparison with plsY enzymes from other cyanobacteria

    • Evolutionary analysis of substrate preference

How does plsY activity respond to environmental variables relevant to Prochlorococcus ecology?

Investigating the response of plsY to environmental variables requires a carefully structured experimental approach that reflects the ecological conditions Prochlorococcus experiences in marine environments:

  • Temperature response:

    • Assay plsY activity across 10-30°C range (typical ocean temperature range)

    • Determine temperature optima and thermal stability

    • Compare with growth temperature optima for different Prochlorococcus ecotypes

  • Light regulation:

    • Examine expression and activity patterns under different light intensities

    • Investigate potential light-dependent regulation mechanisms

    • Compare high-light vs. low-light adapted strains

  • Nutrient limitation effects:

    • Analyze activity under phosphate-limited conditions

    • Examine nitrogen limitation effects on enzyme expression

    • Study iron limitation impacts on lipid remodeling

These investigations should employ temporally ordered tables to document changes in plsY activity in response to environmental transitions, facilitating the identification of adaptive patterns .

What techniques are most effective for analyzing plsY integration into membrane systems?

Analyzing plsY integration into membrane systems requires specialized methodologies that address the challenges of working with membrane-associated enzymes:

  • Membrane reconstitution approaches:

    • Liposome incorporation with defined lipid compositions

    • Nanodiscs for controlled membrane environment

    • Activity assays in reconstituted systems vs. detergent-solubilized enzyme

  • Localization studies:

    • Fluorescent protein tagging for in vivo localization

    • Immunogold electron microscopy for high-resolution visualization

    • Membrane fractionation coupled with activity measurements

  • Protein-lipid interaction analysis:

    • Lipid binding assays to identify specific interactions

    • Effects of membrane composition on enzyme activity

    • Hydrogen-deuterium exchange mass spectrometry for interface mapping

The results from these studies should be organized using typologically ordered tables to compare different membrane environments and their effects on plsY function, providing insights into how membrane context influences enzymatic activity .

How should researchers resolve contradictory results in plsY activity measurements?

When confronted with contradictory results in plsY activity measurements, researchers should implement a systematic analytical approach:

  • Methodological reconciliation:

    • Compare assay conditions in detail (buffer composition, pH, temperature)

    • Evaluate detection methods and their limitations

    • Assess enzyme preparation differences (expression system, purification method, storage)

  • Hypothesis testing:

    • Design targeted experiments to test specific causes of discrepancy

    • Use orthogonal methods to verify the same parameter

    • Perform statistical analysis to determine significance of differences

  • Environmental factor analysis:

    • Investigate if differences reflect genuine environmental adaptations

    • Consider if contradictions reveal regulatory mechanisms

    • Examine strain-specific variations in enzyme properties

Documentation using data analysis tables enhances trustworthiness by providing transparency in how contradictions were addressed and resolved . This approach transforms contradictory results from a challenge into an opportunity for deeper understanding of plsY function.

What statistical approaches are most appropriate for analyzing plsY enzyme kinetics?

The analysis of plsY enzyme kinetics requires rigorous statistical approaches to ensure reliable interpretation:

  • Non-linear regression analysis:

    • Direct fitting to Michaelis-Menten or other appropriate kinetic models

    • Determination of confidence intervals for kinetic parameters

    • Comparison of different kinetic models using Akaike Information Criterion

  • Transformation-based analysis:

    • Lineweaver-Burk, Eadie-Hofstee, or Hanes-Woolf transformations

    • Visual identification of kinetic mechanisms

    • Caution regarding statistical limitations of transformations

  • Advanced statistical treatments:

    • Bootstrap analysis for parameter estimation

    • Monte Carlo simulations for error propagation

    • Global fitting for complex kinetic mechanisms

Statistical MethodApplication in plsY ResearchStrengthsLimitations
Non-linear regressionDirect fitting to kinetic equationsMost accurate parameter estimationRequires specialized software
Lineweaver-Burk plotIdentification of inhibition patternsVisual representationDistorts error at low substrate concentrations
Global fittingComplex kinetic mechanism analysisHandles multiple datasets simultaneouslyComputationally demanding
Residual analysisEvaluation of model appropriatenessIdentifies systematic deviationsRequires careful interpretation

What strategies can address low activity of purified recombinant plsY?

When encountering low activity with purified recombinant plsY, researchers should implement a systematic troubleshooting approach:

  • Expression optimization:

    • Lower induction temperature (16-20°C instead of 37°C)

    • Reduce inducer concentration

    • Optimize induction timing based on growth phase

    • Consider specialized E. coli strains for membrane proteins

  • Purification refinement:

    • Test alternative detergents for extraction

    • Minimize time between cell lysis and purification

    • Include stabilizing agents in purification buffers

    • Consider tag position effects (N-terminal vs. C-terminal)

  • Cofactor supplementation:

    • Test divalent cations (Mg²⁺, Mn²⁺, Zn²⁺)

    • Evaluate requirement for specific phospholipids

    • Add reducing agents to prevent oxidation

  • Activity assay optimization:

    • Compare different detection methods

    • Optimize substrate concentrations

    • Adjust assay temperature to match organism's native environment

Documentation of these troubleshooting steps using event listing tables provides a clear audit trail of the optimization process and facilitates reproducibility .

How can researchers develop reliable assays for measuring plsY activity in complex systems?

Developing reliable assays for plsY activity in complex systems requires methodological innovation:

  • Coupled enzyme assays:

    • Link plsY activity to detectable enzymatic reactions

    • Calibrate coupled systems with known standards

    • Control for background activity from cellular extracts

  • Radiotracer methodologies:

    • Use radiolabeled substrates for high sensitivity

    • Develop extraction protocols for product isolation

    • Implement scintillation counting or autoradiography for quantification

  • Mass spectrometry-based approaches:

    • Develop targeted LC-MS/MS methods for product detection

    • Use stable isotope-labeled internal standards

    • Create calibration curves for absolute quantification

  • In vivo activity proxies:

    • Engineer reporter systems linked to plsY function

    • Develop membrane composition assays as functional readouts

    • Create genetic complementation systems for activity verification

These methodological approaches should be validated using co-occurrence tables that document the reliability of different assay systems across various experimental conditions, contributing to the development of standardized protocols for plsY activity measurement .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.