Recombinant Prochlorococcus marinus subsp. pastoris Membrane protein insertase YidC (yidC)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant YidC

Recombinant YidC from Prochlorococcus marinus subsp. pastoris (strain CCMP1986/MED4) is a membrane-integrated chaperone and insertase involved in folding and embedding transmembrane polypeptides into lipid bilayers . Key features include:

PropertyDetails
UniProt IDQ7V0R8
Expression SystemRecombinant production in P. pastoris
Sequence Length379 amino acids (full-length)
TagDetermined during production
StorageTris-based buffer with 50% glycerol at -20°C or -80°C
Key DomainsTransmembrane segments (TM3, TM5), cytoplasmic α-helical hairpin

This protein is commercially available for research in 50 µg quantities, optimized for stability and activity .

Biological Function and Mechanism

YidC operates through two primary modes:

  • Independent Insertase Activity: Facilitates Sec-independent membrane insertion of proteins like Pf3 coat protein by interacting with hydrophobic regions .

  • Cooperative Chaperoning: Accelerates folding of polytopic proteins (e.g., MelB permease) by stabilizing transient intermediates, reducing misfolding risks .

Key Mechanistic Insights:

  • Binding Dynamics: Single-molecule force spectroscopy reveals YidC binds substrates within 2 ms via its cytoplasmic α-helical hairpin, followed by stronger interactions (52 ms) to guide insertion .

  • Dimeric Pore Formation: Under ribosome binding, YidC forms ion-conducting pores, suggesting an alternative insertion pathway .

  • SecYEG Collaboration: Mutations in YidC’s hydrophobic slide (e.g., YidC-5S) disrupt interactions with SecYEG, impairing ATP synthase assembly .

Research Applications

  • Membrane Protein Folding Studies: Used to reconstitute Pf3 coat protein insertion in vitro .

  • Drug Target Exploration: YidC’s role in bacterial viability makes it a candidate for antibiotic development .

  • Biophysical Assays: Fluorescence correlation spectroscopy (FCS) and electrophysiology validate pore formation and substrate interactions .

Ecological and Genomic Context of the Source Organism

Prochlorococcus marinus subsp. pastoris CCMP1986 is a high-light-adapted marine cyanobacterium with a minimal genome (1.66 Mbp, 1,796 genes) . Its YidC homolog reflects evolutionary adaptations to oligotrophic environments, where efficient membrane protein biogenesis is critical for photosynthetic dominance .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag, please inform us, and we will prioritize its inclusion in the production process.
Synonyms
yidC; PMM1186; Membrane protein insertase YidC; Foldase YidC; Membrane integrase YidC; Membrane protein YidC
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-379
Protein Length
full length protein
Species
Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / NIES-2087 / MED4)
Target Names
yidC
Target Protein Sequence
MIGFISEKLLIPILDFFYGLVPSYGLAIVALTVVIRIALFPLSAGSIRSARRMKIAQPVM QKRQAEIKSKFSSDPKKQQEELGKLMNEFGSPLAGCLPLIVQMPVLFALFATLRGSPFAD VPYNINLKVLPQDQIAAIDPKPYKSPRHSIFVTEKSHFPVIATLPNGTKLGSEESVKINL QTTNGNNYSEVLSNYDNGSRFLPTWTVSKGSENIKVSQDGLVTAIKPGDATIEAKIPGLA AKSGFLFIKALGQVGFYVDGSINWDIATLVGAFGLTLLLSQVLSSQGMPSNAQQSTANKI TPVMITGMFLFFPLPAGVLLYMVVANIFQAFQTFLLNKEALPANLQKILDDQLTGKNKVI PSTANISDKRLPFEPNNKK
Uniprot No.

Target Background

Function
Essential for the insertion, proper folding, and complex formation of integral membrane proteins within the membrane. It facilitates the integration of membrane proteins, both those dependent and independent of the Sec translocase complex, as well as certain lipoproteins. Furthermore, it assists in the folding of multispanning membrane proteins and likely contributes to the insertion, folding, and/or assembly of membrane complexes destined for the thylakoid.
Database Links

KEGG: pmm:PMM1186

STRING: 59919.PMM1186

Protein Families
OXA1/ALB3/YidC family, Type 1 subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is YidC insertase and why is it significant in Prochlorococcus marinus?

YidC is a universally conserved membrane protein insertase that facilitates the insertion and folding of transmembrane polypeptides into lipid bilayers. In Prochlorococcus marinus, one of the most abundant photosynthetic organisms on Earth, YidC plays a crucial role in maintaining the integrity of photosynthetic and other membrane-bound protein complexes. Prochlorococcus is a genus of very small (0.6 μm) marine cyanobacteria with unusual pigmentation (chlorophyll a2 and b2) and represents a significant portion of marine photosynthetic picoplankton . The YidC insertase in this organism is particularly important for cellular viability as it ensures proper membrane protein topology and function in an organism that dominates oceanic photosynthesis.

How does YidC from Prochlorococcus compare structurally to YidC from model organisms like E. coli?

While the search results don't provide specific structural data on Prochlorococcus YidC, we can infer similarities based on the highly conserved nature of YidC across bacterial species. E. coli YidC contains five transmembrane helices forming a hydrophobic groove with a conserved arginine residue (R366) that plays an important role in substrate recognition and insertion . Prochlorococcus YidC likely maintains these core structural elements, though potentially with adaptations that reflect its marine environment and the specific membrane proteins it processes.

Unlike E. coli YidC, which contains a large 320 amino acid-long periplasmic loop (P1) between the first two membrane helices that may facilitate dimerization , Prochlorococcus YidC might have evolved structural modifications that suit its compact genome and specialized photosynthetic membrane organization. Crystallographic and bioinformatic analyses of YidC homologs suggest the functional unit could be monomeric or dimeric depending on the specific cellular context and substrate .

What experimental systems are suitable for studying recombinant Prochlorococcus YidC?

For recombinant expression of Prochlorococcus YidC, several expression systems can be employed:

Expression SystemAdvantagesLimitationsAppropriate Applications
E. coliHigh yield, established protocols, ease of genetic manipulationMay not replicate post-translational modifications, potential toxicityInitial structural studies, antibody production, basic functional assays
Cell-free systemsAvoids toxicity issues, rapid productionHigher cost, limited post-translational modificationsRapid screening of variants, incorporation of non-natural amino acids
Yeast expressionBetter for eukaryotic-like post-translational modificationsLower yield than bacterial systems, more complex protocolsStudies requiring specific folding conditions
Native ProchlorococcusMost physiologically relevantDifficult to culture, low yield, limited genetic toolsValidation of in vivo function

When studying recombinant Prochlorococcus YidC, researchers should consider using methods similar to those described for E. coli YidC, including purification with n-dodecyl β-D-maltoside (DDM) detergent and reconstitution into proteoliposomes for functional studies .

How does YidC facilitate membrane protein insertion independently of the SecYEG translocon?

YidC can operate in two distinct modes: independently and in association with the SecYEG translocon. In its independent mode, YidC directly facilitates the insertion of certain membrane proteins into the lipid bilayer. Based on the search results, there's evidence from E. coli studies showing that YidC can insert certain polytopic membrane proteins in the absence of the SecYEG translocon .

The mechanism likely involves:

  • Recognition of transmembrane segments of the substrate protein

  • Interaction of the substrate's hydrophilic regions with YidC's water-filled groove containing a conserved arginine residue

  • Stepwise insertion of the substrate into the membrane, with YidC acting as a chaperone to prevent misfolding

  • Release of the properly inserted protein into the lipid bilayer

In vivo experiments using conditionally depleted E. coli strains have demonstrated that certain membrane proteins like MelB can insert in the absence of SecYEG if YidC is present in the cytoplasmic membrane . This suggests that Prochlorococcus YidC likely possesses similar independent insertase capability, particularly for simpler membrane proteins with fewer transmembrane segments.

What is the evidence for YidC oligomerization, and how might this affect its function in Prochlorococcus?

Recent research indicates that YidC may function as a dimer rather than exclusively as a monomer as previously thought. Several lines of evidence from E. coli YidC studies support potential dimerization:

  • BN-PAGE analysis of native vesicles shows higher-order YidC complexes

  • Fluorescence correlation spectroscopy studies suggest oligomerization

  • Single-molecule fluorescence photobleaching observations indicate multiple YidC units

  • Crosslinking experiments demonstrate proximity between YidC molecules

  • AlphaFold modeling predicts a parallel YidC dimer with a central pore

The dimeric assembly of YidC may provide an alternative insertion mechanism wherein the conserved arginine and other residues interacting with nascent chains point into a putative central pore. This suggests YidC dimers might form an ion-conducting transmembrane pore upon ribosome or ribosome-nascent chain complex (RNC) binding .

In Prochlorococcus, which has evolved under the selective pressures of oligotrophic marine environments, YidC dimerization might be particularly important for efficiently inserting photosynthetic membrane proteins while maintaining membrane integrity.

How does YidC interact with ribosome-nascent chain complexes during co-translational membrane protein insertion?

YidC interacts with ribosome-nascent chain complexes (RNCs) during co-translational membrane protein insertion through several key mechanisms:

  • Pore formation: Purified and reconstituted E. coli YidC forms an ion-conducting transmembrane pore upon ribosome or RNC binding . This suggests that when the ribosome delivers a nascent membrane protein to YidC, the insertase undergoes conformational changes that create a protected environment for membrane insertion.

  • Substrate recognition: The hydrophobic surface of YidC's water-filled groove, containing a conserved arginine residue (R366 in EcYidC), facilitates the sliding of the substrate's hydrophilic and negatively charged regions during insertion .

  • Stepwise insertion: In vitro single-molecule force spectroscopy with the MelB substrate revealed that insertion proceeds through distinct folding cores, with structural segments inserting stepwise into the membrane. YidC accelerates this process and prevents misfolding, particularly in regions where structural domains interface .

For Prochlorococcus YidC, these interactions would be particularly important for the efficient insertion of photosynthetic proteins that are essential for the organism's survival in low-nutrient ocean environments.

What are the recommended protocols for purifying and reconstituting functional Prochlorococcus YidC?

Based on the established protocols for E. coli YidC, here is a recommended procedure for purifying and reconstituting Prochlorococcus YidC:

Purification Protocol:

  • Express recombinant His-tagged Prochlorococcus YidC in an appropriate E. coli strain (e.g., BL21)

  • Harvest cells and resuspend in buffer containing 50 mM Tris/HCl pH 7.5, 300 mM NaCl, 10 mM Mg(Ac)₂

  • Lyse cells using French press or similar method

  • Remove cell debris via centrifugation (15,800 rpm, 30 min)

  • Isolate membranes by ultracentrifugation (45,000 rpm, 1.5 h)

  • Solubilize membrane pellets in 1% n-dodecyl β-D-maltoside (DDM) with 10% glycerol

  • Purify using metal affinity chromatography (e.g., TALON® resin)

  • Wash with buffer containing 40 mM imidazole, 10% glycerol, 50 mM Tris/HCl pH 7.5, 300 mM NaCl, 10 mM Mg(Ac)₂, and 0.03% DDM

  • Elute with buffer containing 200 mM imidazole

Reconstitution into Proteoliposomes:

  • Mix n-octyl-β-D-glycoside with purified YidC (1.5 μM) in DDM

  • Incubate for 20 min at 4°C

  • Dialyze against 50 mM TeaOAc, pH 7.5, 1 mM DTT

  • Pellet proteoliposomes (210,000× g, 1 h)

  • Resuspend in 50 mM TeaOAc, pH 7.5, 1 mM DTT to a final protein concentration of 5 μM

  • Use a YidC-to-lipid ratio of 1:100 (m%)

The functional activity of reconstituted YidC can be verified by its ability to insert model membrane proteins like MtlA or TatC .

How can researchers effectively label YidC for tracking its dynamics in membrane environments?

For tracking YidC dynamics in membrane environments, site-specific fluorescent labeling is an effective approach. Based on the protocols described for E. coli YidC:

  • Create a single-cysteine YidC variant:

    • Generate a cysteine-free YidC background (e.g., C423S mutation)

    • Introduce a single cysteine at an accessible but non-disruptive position (e.g., position D269C in E. coli YidC)

  • Fluorescent labeling procedure:

    • Incubate purified YidC with reducing agent (e.g., 100 μM TCEP) for 5 min on ice

    • Add ten-fold molar excess of maleimide-conjugated fluorophore (e.g., ATTO-488-maleimide)

    • Incubate for 2 h on ice

    • Remove excess dye by desalting via PD10 columns

    • Proceed with reconstitution into liposomes

  • Alternative labeling approaches:

    • Genetically encoded fluorescent tags (GFP, mCherry) for in vivo studies

    • Incorporation of unnatural amino acids with bio-orthogonal chemistry for specific labeling

    • SNAP or CLIP tags for versatile labeling options

After labeling, several techniques can be used to study YidC dynamics:

  • Fluorescence correlation spectroscopy (FCS) to analyze diffusion and oligomerization

  • Single-molecule fluorescence microscopy to detect individual YidC molecules

  • Förster resonance energy transfer (FRET) to measure YidC interactions with substrates or other proteins

What assays can be used to measure YidC-mediated membrane protein insertion activity?

Several assays can be employed to measure YidC-mediated membrane protein insertion activity:

Assay TypePrincipleAdvantagesLimitationsData Output
Planar lipid bilayer electrophysiologyMeasures ion conductance across YidC-containing bilayers in the presence of ribosomes or RNCsDirect measurement of pore formation; real-time dataTechnical complexity; artificial environmentIon conductance traces showing channel opening/closing events
Single-molecule force spectroscopyMeasures force required to unfold membrane proteins inserted with YidC assistanceProvides insight into folding energy landscape and insertion intermediatesRequires specialized equipment; low throughputForce-extension curves revealing folding cores and stability
Protease protection assaysMeasures protection of inserted regions from protease digestionSimple setup; biochemical verification of insertionIndirect measure; potential artifacts from incomplete digestionGel bands showing protected fragments
Fluorescence-based insertion assaysUses fluorescent reporters to monitor insertion eventsCan be real-time; potential for high throughputMay require protein modification; potential interferenceFluorescence intensity changes over time
Crosslinking assaysIdentifies interaction sites between YidC and substrate proteinsMaps substrate interaction sites; works in vivoChemical modification required; potential artifactsCrosslinked adducts visible on SDS-PAGE

For example, planar bilayer electrophysiology has been used to demonstrate that E. coli YidC forms ion-conducting pores upon binding to ribosomes or RNCs. In these experiments, YidC-containing proteoliposomes are added to planar lipid bilayers, and current measurements are taken before and after the addition of ribosomes or RNCs .

How do specific YidC mutations affect its function in membrane protein insertion?

YidC mutations can significantly impact its function in membrane protein insertion. The conserved arginine residue (R366 in E. coli YidC) located within the hydrophobic groove has been extensively studied:

  • While important for function, the arginine is not absolutely essential in E. coli YidC unless the hydrophilicity of the groove is reduced . This suggests some redundancy in the mechanism by which YidC facilitates membrane protein insertion.

  • Mutations affecting the dimeric interface of YidC can impact its ability to form functional complexes. Potential dimerization interfaces have been identified on TM3 or TM5 , and mutations in these regions would likely affect the formation of any potential pore structure.

  • For Prochlorococcus YidC, mutations might have more severe consequences given the organism's streamlined genome and dependence on efficient photosynthetic membrane protein insertion.

A comprehensive mutational analysis approach could involve:

Mutation TargetExpected EffectExperimental ReadoutRelevance to Prochlorococcus
Conserved arginineReduced insertion efficiency for substrates with charged N-terminiDecreased growth rates; impaired insertion of model substratesCritical for insertion of photosystem components
TM3/TM5 interface residuesDisrupted dimerization; altered pore formationChanges in oligomeric state visible by BN-PAGE; altered channel activityMay affect adaptation to marine environment conditions
Periplasmic loopAltered interactions with substrate proteins or ribosomesChanged crosslinking patterns; modified ribosome bindingPotential specialized interactions with Prochlorococcus-specific substrates
C-terminal tailModified interactions with other insertion factorsAltered co-immunoprecipitation patternsMay reveal Prochlorococcus-specific protein interaction networks

What is the relationship between YidC and the SecYEG translocon in Prochlorococcus, and how do they coordinate membrane protein insertion?

The relationship between YidC and the SecYEG translocon involves two distinct modes of operation:

  • YidC-assisted SecYEG-dependent insertion: In this mode, YidC functions as part of the SecYEG complex, binding to the lateral gate of SecYEG . YidC enhances the release of transmembrane helices from the SecY channel, facilitates their subsequent folding, and may promote the assembly of multi-subunit membrane protein complexes .

  • YidC-independent insertion: YidC can insert certain membrane proteins independently of SecYEG . This pathway may be particularly important for less complex membrane proteins, potentially easing the transport load of the SecYEG translocon, which is present in relatively small numbers in bacterial membranes .

Coordination between these pathways appears to involve:

  • The signal recognition particle (SRP) pathway, which can deliver some multi-spanning membrane proteins to either SecYEG or YidC, suggesting pathway promiscuity for certain substrates

  • Specific structural features of substrates that determine their preferred insertion pathway

  • Potential physical interactions between YidC and SecYEG components that facilitate handoff of certain substrates

In Prochlorococcus, with its streamlined genome and specialized photosynthetic apparatus, this coordination may be particularly refined to ensure efficient insertion of critical photosynthetic membrane proteins while conserving cellular resources.

How does the marine environment influence YidC function in Prochlorococcus compared to terrestrial bacteria?

The marine environment likely imposes unique selective pressures on YidC function in Prochlorococcus:

  • Adaptation to constant osmotic pressure: Unlike many terrestrial bacteria that face variable osmotic conditions, Prochlorococcus lives in a relatively stable osmotic environment. This may have allowed specialization of YidC to function optimally within narrower parametric ranges.

  • Nutrient limitations: As one of the most abundant photosynthetic organisms in oligotrophic oceans , Prochlorococcus has evolved under extreme nutrient limitations. Its YidC may be optimized for energy efficiency, possibly with streamlined mechanisms or narrower substrate specificity focused on essential photosynthetic components.

  • Light adaptation: Prochlorococcus contains unusual pigmentation (chlorophyll a2 and b2) for capturing the available light in its marine environment. YidC would need to efficiently insert the specific membrane proteins associated with these specialized photosystems.

  • Temperature stability: Marine environments typically have more stable temperatures than terrestrial ones. Prochlorococcus YidC may lack the broad temperature tolerance seen in some terrestrial bacteria, instead being optimized for performance within a narrower temperature range.

  • Salinity adaptation: The constant high salinity of marine environments may have selected for specific structural features in Prochlorococcus YidC that maintain optimal function under these ionic conditions, potentially affecting its ion-conducting properties or interactions with substrate proteins.

What are common issues in recombinant expression of Prochlorococcus YidC and how can they be addressed?

Common issues in recombinant expression of membrane proteins like Prochlorococcus YidC include:

IssuePotential CausesTroubleshooting Strategies
Low expression yieldToxicity to host; codon bias; protein instabilityUse tightly regulated inducible promoters; codon optimization; lower induction temperature (e.g., 18-20°C); use C41/C43 E. coli strains specialized for membrane proteins
Inclusion body formationOverexpression; improper folding; inadequate membrane insertionReduce expression rate; co-express chaperones; add membrane-mimetic detergents during lysis
Protein aggregation during purificationInadequate detergent concentration; improper buffer conditionsScreen different detergents (DDM, LMNG, etc.); optimize buffer pH and salt concentration; add stabilizing agents like glycerol
Poor reconstitution into liposomesIncompatible lipid composition; detergent removal issuesTest different lipid compositions including E. coli polar lipids; optimize detergent removal method (dialysis vs. Bio-Beads)
Loss of function after purificationDelipidation; conformational changes; loss of essential cofactorsAdd specific lipids during purification; maintain reducing conditions if cysteines are present; avoid excessive concentration steps

Based on protocols used for E. coli YidC, successful expression might involve:

  • Using BL21 strain with pTrc99a-YidC expression vector

  • Growing cultures to OD600 of 0.5-0.8 before induction

  • Inducing with 0.5 mM IPTG

  • Harvesting after 2-3 hours of expression at lower temperatures (25-30°C)

  • Solubilizing membranes with 1% DDM

  • Purifying via metal affinity chromatography using appropriate washing and elution buffers

How can researchers differentiate between YidC-dependent and SecYEG-dependent insertion pathways experimentally?

Differentiating between YidC-dependent and SecYEG-dependent insertion pathways experimentally requires strategic approaches:

  • Genetic depletion systems:

    • Use conditional YidC depletion strains (like E. coli JS7131) where YidC expression can be controlled

    • Similarly, use SecYEG depletion strains

    • Test insertion of the membrane protein of interest under conditions where either YidC or SecYEG is depleted

    • As demonstrated for MelB, some proteins can insert via YidC alone in the absence of SecYEG

  • Reconstituted systems:

    • Prepare proteoliposomes containing either purified YidC, SecYEG, or both

    • Test insertion of radiolabeled or fluorescently labeled substrate proteins

    • Compare insertion efficiency between different proteoliposome preparations

  • Crosslinking approaches:

    • Use site-specific crosslinkers to capture interactions between nascent chains and either YidC or SecY

    • In vivo photo-crosslinking with incorporated unnatural amino acids (like pBpa) can identify interactions during translation

    • Analysis of crosslinked products can reveal which pathway is predominantly used

  • Substrate mutations:

    • Introduce mutations in substrate proteins that specifically affect interaction with either YidC or SecYEG

    • Monitor how these mutations affect insertion efficiency

    • Identify sequence determinants that direct proteins to specific pathways

  • Real-time insertion assays:

    • Use planar bilayer electrophysiology to monitor pore formation by YidC upon ribosome binding

    • Compare ion conductance properties between YidC and SecYEG channels

    • Analyze how different substrate proteins affect channel behavior

What considerations are important when studying YidC-mediated insertion of photosynthetic proteins specific to Prochlorococcus?

When studying YidC-mediated insertion of photosynthetic proteins specific to Prochlorococcus, several important considerations must be addressed:

  • Specialized photosynthetic machinery: Prochlorococcus contains unusual photosynthetic pigments (chlorophyll a2 and b2) and has adapted to low-light environments. Its photosynthetic membrane proteins likely have unique features that may require specialized YidC-mediated insertion mechanisms.

  • Experimental growth conditions: Prochlorococcus has specific growth requirements that differ from model organisms:

    • Light intensity and quality must be carefully controlled

    • Seawater-based growth media with appropriate nutrient levels are required

    • Temperature ranges must be maintained within the relatively narrow optimal range

  • Reconstitution considerations:

    • Lipid composition for reconstitution studies should ideally reflect the unique membrane composition of Prochlorococcus

    • The ionic strength of buffers should mimic marine conditions

    • Detergent selection may need optimization for Prochlorococcus membrane proteins

  • Technical challenges:

    • Low biomass yields from Prochlorococcus cultures may necessitate scaling up or developing more efficient purification strategies

    • The small cell size (0.6 μm) can complicate certain cellular fractionation approaches

    • Genetic manipulation of Prochlorococcus is more challenging than in model organisms

  • Heterologous expression considerations:

    • Codon optimization may be necessary due to the high AT content of Prochlorococcus genes

    • Expression hosts may need supplementation with specific cofactors required by Prochlorococcus photosynthetic proteins

    • Lower expression temperatures may better accommodate the folding of proteins evolved for marine environments

  • Functional assays:

    • Activity assays for photosynthetic proteins should measure parameters relevant to Prochlorococcus physiology

    • Consideration of how light harvesting differs in this organism compared to model photosynthetic bacteria

    • Integration of inserted proteins into functional photosynthetic complexes may require additional factors

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.