Recombinant Prochlorococcus marinus subsp. pastoris NAD (P)H-quinone oxidoreductase subunit 3 (ndhC)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline for your use.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer components, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. Please specify your required tag type for preferential development.
Synonyms
ndhC; PMM0294; NAD(PH-quinone oxidoreductase subunit 3; NAD(PH dehydrogenase subunit 3; NADH-plastoquinone oxidoreductase subunit 3; NDH-1 subunit 3; NDH-C
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-120
Protein Length
full length protein
Species
Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / NIES-2087 / MED4)
Target Names
ndhC
Target Protein Sequence
MFSLPGYEYFLGFLIIAAAVPILALVTNLIVSPKGRTGERKLTYESGMEPIGGAWIQFNI RYYMFALVFVIFDVETVFLYPWAVAFNRLGLLAFIEALIFITILVIALAYAWRKGALEWS
Uniprot No.

Target Background

Function
NDH-1 facilitates electron transfer from an unidentified donor, via FMN and iron-sulfur (Fe-S) centers, to quinones within the respiratory and/or photosynthetic electron transport chain. In this organism, plastoquinone is considered the primary electron acceptor. The enzyme couples this redox reaction to proton translocation, conserving redox energy as a proton gradient. In cyanobacteria, NDH-1 also participates in inorganic carbon concentration.
Database Links

KEGG: pmm:PMM0294

STRING: 59919.PMM0294

Protein Families
Complex I subunit 3 family
Subcellular Location
Cellular thylakoid membrane; Multi-pass membrane protein.

Q&A

What is NAD(P)H-quinone oxidoreductase subunit 3 (ndhC) and how does it compare to other subunits?

NAD(P)H-quinone oxidoreductase subunit 3 (ndhC) is a component of the NAD(P)H dehydrogenase complex in Prochlorococcus marinus subsp. pastoris. Similar to the ndhB subunit (subunit 2), it participates in electron transport chains and is involved in energy metabolism. While ndhB (subunit 2) is well-characterized as a functional component that catalyzes the two-electron reduction of quinone to hydroquinone using NADPH, ndhC represents another critical component of this multi-subunit enzyme complex . Both are integral parts of the same enzyme complex but differ in their specific functions within the electron transport mechanism. The homology between these subunits reflects their evolutionary relationship while maintaining distinct functional roles in the photosynthetic apparatus of this marine cyanobacterium.

What are the optimal storage conditions for recombinant ndhC protein?

Based on data from related recombinant proteins from the same organism, recombinant ndhC protein storage should follow these guidelines:

  • For liquid formulations, store at -20°C/-80°C with an expected shelf life of approximately 6 months

  • For lyophilized formulations, store at -20°C/-80°C with an expected shelf life of approximately 12 months

  • Avoid repeated freezing and thawing cycles which significantly reduce protein stability

  • Working aliquots can be stored at 4°C for up to one week

When preparing for storage, it is recommended to add glycerol (final concentration 5-50%, with 50% being optimal for many applications) to stabilize the protein structure during freeze-thaw cycles . This significantly extends shelf life and maintains structural integrity for downstream applications.

What reconstitution protocols should be followed for optimal ndhC protein activity?

For optimal reconstitution of lyophilized recombinant ndhC:

  • Briefly centrifuge the vial prior to opening to bring contents to the bottom

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (with 50% being standard practice) for long-term storage preparations

  • Gently mix until completely dissolved, avoiding vigorous shaking which may cause protein denaturation

For specialized applications requiring buffer systems other than water, ensure the buffer pH and ionic strength are compatible with protein stability (typically pH 7.2-7.4 for most recombinant proteins in this family).

How should experiments be designed to study ndhC function and activity?

When designing experiments to study ndhC function, follow these systematic steps:

  • Define your variables clearly:

    • Independent variable: Typically the conditions you're manipulating (e.g., substrate concentration, temperature, pH)

    • Dependent variable: The measured output (e.g., enzyme activity, electron transfer rate)

    • Control for extraneous variables that might influence results

  • Formulate specific, testable hypotheses about ndhC function

  • Design experimental treatments with appropriate controls:

    • Positive controls (known functional related proteins like ndhB)

    • Negative controls (denatured protein or buffer-only samples)

  • Determine subject assignment strategy (between-subjects or within-subjects design)

  • Establish clear measurement protocols for dependent variables

Variable TypeExamples for ndhC ResearchMeasurement Approach
IndependentTemperature, pH, ionic strengthCarefully controlled and systematically varied
DependentEnzyme activity, electron transfer rateSpectrophotometric assays, oxygen consumption
ConfoundingProtein purity, storage conditionsStandardized preparation protocols

What methodologies are recommended for measuring ndhC enzymatic activity?

For measuring ndhC enzymatic activity, the following methods are recommended based on approaches used with related NAD(P)H-quinone oxidoreductase proteins:

  • Spectrophotometric assays: Monitor the oxidation of NADPH at 340 nm, calculating activity based on the rate of NADPH consumption in the presence of appropriate quinone substrates

  • ROS scavenging assessment: Measure the protein's ability to reduce reactive oxygen species using fluorescent probes such as DCFDA (2',7'-dichlorofluorescin diacetate)

  • Oxygen consumption analysis: Using oxygen electrodes to measure changes in oxygen concentration during enzymatic reactions

  • Coupled enzyme assays: Where the product of the ndhC reaction serves as a substrate for a secondary enzyme with more easily measurable activity

When conducting these assays, it is critical to establish appropriate controls and account for background rates of spontaneous reactions. Temperature, pH, and ionic strength should be carefully controlled and reported to ensure reproducibility.

How can contradictions in experimental data regarding ndhC be systematically analyzed?

When dealing with contradictory experimental data in ndhC research, a structured approach to contradiction analysis can be applied:

  • Define the contradiction pattern: Consider the three key parameters:

    • α: The number of interdependent items in your dataset

    • β: The number of contradictory dependencies defined by domain experts

    • θ: The minimal number of Boolean rules required to assess these contradictions

  • Implement a systematic evaluation method:

    • Identify the specific biomedical domain knowledge relevant to ndhC

    • Apply informatics domain knowledge for efficient implementation in assessment tools

    • Use Boolean minimization techniques to reduce complex contradiction patterns to their simplest form

  • Document contradiction patterns using standardized notation to facilitate comparison across studies and domains

This structured analysis helps handle the complexity of multidimensional interdependencies within datasets and supports the implementation of generalized contradiction assessment frameworks . When applied to ndhC research, this approach can help reconcile seemingly contradictory findings about protein function, activity, or interactions.

What controls should be included when studying potential interactions between ndhC and other proteins?

When studying protein-protein interactions involving ndhC, the following controls are essential:

  • Negative controls:

    • Non-specific proteins of similar size/structure but not expected to interact

    • Buffer-only controls

    • Denatured protein controls to confirm specificity of structural interactions

  • Positive controls:

    • Known interacting partners from the same complex (e.g., ndhB)

    • Artificially tagged fusion proteins with verified interaction capabilities

  • Validation controls:

    • Orthogonal methods to confirm interactions (e.g., if using co-immunoprecipitation, also validate with FRET or bioluminescence resonance energy transfer)

    • Concentration gradients to determine specificity and saturation kinetics

  • Experimental condition controls:

    • pH variations to assess ionic interaction dependencies

    • Salt concentration variations to evaluate hydrophobic vs. ionic interactions

    • Temperature variations to assess thermodynamic parameters

These controls help distinguish specific from non-specific interactions and provide robust validation of experimental findings related to ndhC protein interactions.

How can ndhC be studied in the context of ROS scavenging mechanisms?

NAD(P)H quinone oxidoreductases function as scavengers for reactive oxygen species (ROS) . To study ndhC in this context:

  • ROS generation systems:

    • Establish controlled ROS generation systems using chemical inducers (H₂O₂, paraquat) or physical methods (UV irradiation)

    • Quantify baseline ROS levels using fluorescent probes

  • Comparative analysis:

    • Compare ROS levels in systems with and without functional ndhC

    • Analyze dose-dependent relationships between ndhC concentration and ROS reduction

  • Mechanistic investigations:

    • Study the effect of site-directed mutagenesis on ROS scavenging activity

    • Investigate potential redox partners and electron transfer pathways

  • Physiological relevance:

    • Examine the impact of environmental stressors on ndhC expression and activity

    • Correlate ndhC activity with cellular oxidative stress markers

Recent studies with related quinone oxidoreductases have demonstrated their importance in regulating oxidative stress. For example, NQO1 deficiency has been shown to affect T helper 17 cell induction through elevated intracellular ROS levels . This suggests that ndhC may similarly have roles beyond basic electron transport, potentially including stress response regulation in Prochlorococcus marinus.

What approaches are recommended for studying ndhC expression patterns under different environmental conditions?

To investigate ndhC expression patterns under varying environmental conditions:

  • Transcriptional analysis:

    • qRT-PCR to quantify ndhC mRNA levels under different conditions

    • RNA-seq for genome-wide expression context

    • Promoter analysis using reporter constructs

  • Translational and post-translational investigation:

    • Western blotting to quantify protein levels

    • Pulse-chase experiments to determine protein turnover rates

    • Post-translational modification analysis (phosphorylation, acetylation)

  • Experimental design considerations:

    • Systematic variation of environmental parameters (light intensity, temperature, nutrient availability)

    • Time-course studies to capture dynamic responses

    • Multiple biological and technical replicates to ensure statistical reliability

Environmental ConditionMeasurement ParametersExpected Response
Light intensity variationsndhC transcript levels, protein accumulation, enzymatic activityPotential upregulation under high light conditions due to increased electron transport needs
Nutrient limitationProtein expression ratios, post-translational modificationsPossible compensatory mechanisms under stress
Temperature stressStability of protein complex, assembly kineticsAdaptation of complex stoichiometry or enzyme kinetics

This systematic approach allows for comprehensive characterization of ndhC regulation mechanisms and their relationship to environmental adaptation in Prochlorococcus marinus.

How does ndhC from Prochlorococcus marinus compare to homologous proteins in other cyanobacteria?

A comparative analysis of ndhC across cyanobacterial species reveals important evolutionary relationships and functional conservation:

  • Sequence conservation analysis:

    • Core catalytic domains show high conservation across cyanobacteria

    • Species-specific variations occur primarily in peripheral regions

    • Conserved residues often correlate with critical functional sites

  • Structural comparisons:

    • Despite sequence variations, tertiary structure tends to be highly conserved

    • Species-specific adaptations may reflect environmental niche specialization

    • Binding site architecture shows consistent patterns related to substrate specificity

  • Functional divergence:

    • Kinetic parameters may vary reflecting metabolic adaptations

    • Regulatory mechanisms show greater diversity than core catalytic functions

    • Post-translational modification sites exhibit lineage-specific patterns

This comparative approach provides insights into both the fundamental conserved functions of ndhC and the specialized adaptations that have evolved in Prochlorococcus marinus, potentially relating to its unique ecological niche in oligotrophic marine environments.

What methodologies are most effective for studying the integration of ndhC into functional enzyme complexes?

To study how ndhC integrates into functional enzyme complexes:

  • Structural biology approaches:

    • Cryo-electron microscopy to visualize intact complexes

    • X-ray crystallography for high-resolution structural details

    • Hydrogen-deuterium exchange mass spectrometry to map interaction interfaces

  • Biochemical characterization:

    • Blue native PAGE to isolate intact complexes

    • Size exclusion chromatography combined with multi-angle light scattering

    • Crosslinking mass spectrometry to identify proximity relationships

  • Functional assessment:

    • Activity assays with reconstituted complexes

    • Mutational analysis of interaction interfaces

    • In vitro assembly/disassembly kinetics

  • Experimental design considerations:

    • Control for protein stoichiometry

    • Assess impact of environmental conditions on complex stability

    • Compare wild-type vs. mutant complexes to identify critical interaction residues

These methodologies enable researchers to understand not only the structure of ndhC but how it functionally integrates with other subunits to form a complete NAD(P)H-quinone oxidoreductase complex capable of efficient electron transfer and ROS scavenging activities.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.