Recombinant Prochlorococcus marinus subsp. pastoris NAD (P)H-quinone oxidoreductase subunit L (ndhL)

Shipped with Ice Packs

In Stock

Cat. No.

BT2037622

Source

in vitro E.coli expression system

Synonyms

ndhL; PMM0570; NAD(PH-quinone oxidoreductase subunit L; NAD(PH dehydrogenase I subunit L; NDH-1 subunit L; NDH-L

Quick Inquiry

Description

Functional Role in Cyanobacteria

NdhL contributes to two critical processes:

Photosynthesis: Facilitates cyclic electron flow around Photosystem I, essential for ATP synthesis in low-nutrient marine environments .
Respiratory Chain: Participates in redox reactions by transferring electrons from NAD(P)H to plastoquinone .

Comparative studies suggest horizontal gene transfer (HGT) events between Prochlorococcus and Synechococcus species, which may explain the widespread distribution of ndhL homologs in marine cyanobacteria .

Production Systems

Host System	Advantages	Yield/Purity
E. coli	Cost-effective, high scalability	≥85% purity
Mammalian Cells	Post-translational modifications	Lower yield, higher complexity
Cell-Free Expression	Rapid production, no host contaminants	Moderate purity

Applications

Biochemical Research: Study of electron transport mechanisms in marine cyanobacteria .
Bioenergy: Engineered into microbial systems for enhanced ATP production .
Environmental Adaptation: Insights into Prochlorococcus’s survival in oligotrophic oceans .

Key Research Findings

Evolutionary Insights: Phylogenetic analyses reveal that ndhL is part of a core set of 1,273 genes shared across all Prochlorococcus strains, underscoring its essential role .
Ecological Impact: Prochlorococcus contributes ~20% of global photosynthetic oxygen production, with NdhL supporting its dominance in nutrient-poor waters .
Gene Transfer: Evidence of HGT between Prochlorococcus and Synechococcus spp. highlights the enzyme’s evolutionary adaptability .

Biochemical Properties

Parameter	Specification
Storage	-20°C or -80°C in Tris-based buffer with 50% glycerol
Stability	Avoid repeated freeze-thaw cycles
Sequence	MESIFNNSFATLVAYVGIVSIYLLVIPLILFYWMNNRWNVMGKFERLIVYGLVFLFFPGLILFSPFLNLRLRGDSKG

Product Specs

Form

Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.

Lead Time

Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.

Notes

Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.

Reconstitution

Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted to customer preference.

Shelf Life

Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.

Storage Condition

Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.

Tag Info

Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.

Synonyms

ndhL; PMM0570; NAD(PH-quinone oxidoreductase subunit L; NAD(PH dehydrogenase I subunit L; NDH-1 subunit L; NDH-L

Buffer Before Lyophilization

Tris/PBS-based buffer, 6% Trehalose.

Datasheet

Please contact us to get it.

Expression Region

1-77

Protein Length

full length protein

Species

Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / NIES-2087 / MED4)

Target Names

ndhL

Target Protein Sequence

MESIFNNSFATLVAYVGIVSIYLLVIPLILFYWMNNRWNVMGKFERLIVYGLVFLFFPGL ILFSPFLNLRLRGDSKG

Uniprot No.

Q7V2B1

Target Background

Function

NDH-1 (NAD(P)H-quinone oxidoreductase subunit L) facilitates electron transfer from an unidentified donor, utilizing FMN and iron-sulfur (Fe-S) centers, to quinones within the respiratory and/or photosynthetic electron transport chain. In this organism, plastoquinone is considered the primary electron acceptor. The enzyme couples this redox reaction to proton translocation, thereby conserving energy within a proton gradient. In cyanobacteria, NDH-1 also plays a crucial role in inorganic carbon concentration.

Database Links

KEGG: pmm:PMM0570

STRING: 59919.PMM0570

Protein Families

Complex I NdhL subunit family

Subcellular Location

Cellular thylakoid membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected

Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *

Name*

Email*

Phone

Country

Source

Quantity&Size*

Product Name

Message

Recombinant Prochlorococcus marinus subsp. pastoris NAD (P)H-quinone oxidoreductase subunit L (ndhL)

Description

Functional Role in Cyanobacteria

Production Systems

Applications

Key Research Findings

Biochemical Properties

Product Specs

Target Background

Quick Inquiry

Category

Service