Recombinant Prochlorococcus marinus subsp. pastoris Photosystem I assembly protein Ycf4 (ycf4)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Prochlorococcus marinus subsp. pastoris Photosystem I Assembly Protein Ycf4 (ycf4)

Prochlorococcus marinus subsp. pastoris Photosystem I assembly protein Ycf4 (ycf4) is a protein involved in the biogenesis of Photosystem I (PSI) in photosynthetic organisms . Ycf4 is essential for the accumulation of PSI in Chlamydomonas reinhardtii . PSI biogenesis within the thylakoid membrane necessitates the coordinated assembly of protein subunits encoded by both the nucleus and chloroplast, alongside the integration of numerous cofactors like chlorophylls, carotenoids, and iron-sulfur clusters .

The Role of Ycf4 in Photosystem I Assembly

Ycf4 is part of a large complex that includes PSI subunits PsaA, PsaB, PsaC, PsaD, PsaE, and PsaF, as well as COP2 . This complex is believed to act as a scaffold for PSI assembly, facilitating interactions between newly synthesized PSI polypeptides and assisting in the assembly of the PSI complex .

Experimental Evidence and Research Findings

  • Ycf4 Knockout Studies: In tobacco plants, ycf4 knockout mutants exhibit reduced PSI accumulation but can still grow photoautotrophically, indicating Ycf4 is not essential for photosynthesis in higher plants .

  • Biochemical Analysis: Studies have shown that Ycf4 interacts with other proteins, such as COP2, to form a large complex involved in PSI assembly .

  • Pulse-Chase Protein Labeling: Experiments indicate that PSI polypeptides associated with the Ycf4-containing complex are newly synthesized and partially assembled as a pigment-containing subcomplex, supporting the role of Ycf4 in the early stages of PSI assembly .

  • Tandem Affinity Purification (TAP) Tagging: TAP-tagged Ycf4 has been used to purify and study the Ycf4-containing complex, confirming its large size (greater than 1500 kD) and identifying its protein components .

Ycf4 in Different Organisms

  • Chlamydomonas reinhardtii: Ycf4 is essential for PSI complex synthesis and/or stability .

  • Higher Plants (e.g., Nicotiana tabacum): Ycf4 is not essential for photosynthesis but plays a significant role in PSI accumulation .

  • Cyanobacteria: Ycf4 plays a regulatory role, and mutants deficient in Ycf4 can still assemble the PSI complex, although at a reduced level .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for custom preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ycf4; PMM1156; Photosystem I assembly protein Ycf4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-185
Protein Length
full length protein
Species
Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / NIES-2087 / MED4)
Target Names
ycf4
Target Protein Sequence
MQSNLSSFNKIEQKINGSRKISNYLIGGMLSIGGIGFILAAISSYTGRDLLPLGNPSTLL FIPQGIIMGAYGVIANLLNIYLWYLVFINFGSGYNFFDKDSQSVEIKRKGLFKDIEVKLS FDEIKSVKLDISEGFNPRRRIALVLKGRKKPLPLSGAGELKPLLQVEEEGARLAKFLNVN LEGLK
Uniprot No.

Target Background

Function

Appears essential for the assembly of the photosystem I complex.

Database Links

KEGG: pmm:PMM1156

STRING: 59919.PMM1156

Protein Families
Ycf4 family
Subcellular Location
Cellular thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the fundamental role of Ycf4 in photosynthetic organisms?

Ycf4 is a thylakoid membrane protein essential for the accumulation and proper assembly of photosystem I (PSI). Research indicates that it plays a pivotal role in the initial assembly steps of PSI by directly mediating the interactions between newly synthesized PSI polypeptides and assisting in the formation of functional PSI complexes . Studies across different organisms have confirmed its importance, with complete knockout models demonstrating severe impairment of photosynthetic capability . Pulse-chase protein labeling experiments have shown that PSI polypeptides associated with Ycf4-containing complexes are newly synthesized and partially assembled, supporting its role as an assembly factor .

How is the ycf4 gene organized within the chloroplast genome?

The ycf4 gene is encoded in the chloroplast genome. In Chlamydomonas reinhardtii, it is part of the rps9-ycf4-ycf3-rps18 polycistronic transcriptional unit . This organization is significant as it places ycf4 in the context of other genes involved in photosynthetic function and chloroplast protein synthesis. The genomic context provides insights into the co-regulation of genes necessary for photosystem assembly and function. Experimental approaches targeting this gene typically involve chloroplast transformation techniques with homologous recombination to introduce modifications or deletions .

What experimental evidence confirms the essentiality of Ycf4 for photosynthesis?

Multiple lines of experimental evidence establish Ycf4's essential nature:

  • Complete knockout studies in tobacco demonstrate that Δycf4 plants cannot survive photoautotrophically, requiring external carbon sources for growth .

  • Phenotypic analysis shows that homoplasmic Δycf4 plants develop a light green phenotype that becomes progressively pale yellow as plants age .

  • Transmission electron microscopy reveals significant structural anomalies in chloroplasts of knockout plants, including altered shape, size, and grana stacking .

  • Transcriptome analysis of knockout plants shows decreased expression of key photosynthetic genes including rbcL, LHC, and ATP synthase components .

These findings collectively demonstrate that Ycf4 is not merely an accessory factor but an essential component for photosynthetic function.

What techniques have proven most effective for purifying and characterizing the Ycf4-containing complex?

Successful isolation and characterization of the Ycf4 complex has been achieved through a multi-step approach:

  • Tandem affinity purification (TAP)-tag technology has been effectively employed by fusing calmodulin binding peptide and Protein A domains (separated by a tobacco etch virus protease cleavage site) to the C-terminus of Ycf4 .

  • Two-step affinity column chromatography protocol, involving overnight incubation of thylakoid extracts with IgG agarose at 4°C to ensure efficient adsorption of the TAP-tagged Ycf4 .

  • Sucrose gradient ultracentrifugation followed by ion exchange column chromatography has confirmed the association between Ycf4 and other components like COP2 .

  • Protein identification using mass spectrometry (liquid chromatography–tandem mass spectrometry) and immunoblotting has revealed complex composition .

These methods have demonstrated that the Ycf4-containing complex is larger than 1500 kD and contains multiple protein components, including PSI subunits.

What is known about the structural characteristics of the Ycf4-containing complex?

Electron microscopy studies have revealed that the Ycf4-containing complex forms large structures measuring approximately 285 × 185 Å . These structures likely represent several large oligomeric states of the complex. The complex has been shown to contain not only Ycf4 but also the opsin-related protein COP2 and several PSI subunits including PsaA, PsaB, PsaC, PsaD, PsaE, and PsaF . The intimate and exclusive association of Ycf4 and COP2 has been demonstrated through copurification studies, suggesting a functional relationship between these proteins in the PSI assembly process .

How do different domains of Ycf4 contribute to its protein-protein interactions?

Molecular docking studies comparing the full-length Ycf4 protein with its N-terminal (93 amino acids) and C-terminal (91 amino acids) portions have revealed significant functional differences between domains:

  • The C-terminal region forms substantially more hydrogen bonds with photosynthetic proteins than either the full-length protein or the N-terminal portion alone .

  • When interacting with PSI subunits (psaA, psaB, psaC, psaH), the C-terminal portion forms 5-17 hydrogen bonds compared to 1-5 hydrogen bonds for the N-terminal portion .

  • Similar patterns are observed with interactions involving PSII components, ribosomal proteins, ATP synthase subunits, and other photosynthetic proteins .

This data is summarized in the comprehensive hydrogen bond analysis shown in Table 1:

Docked complexHydrogen bonds (full-length YCF4)Bond length rangeHydrogen bonds (amino terminus of YCF4)Bond length rangeHydrogen bonds (carboxyl terminus of YCF4)Bond length range
ycf4+psaA32.85 - 3.0732.84-2.9352.74-3.02
ycf4+psaB72.58 - 3.2252.75-2.89122.61-3.20
ycf4+psaC72.62 - 2.9312.5082.62-3.19
ycf4+psaH72.57 - 3.0142.73-3.05172.57-3.26
ycf4+atpB122.56 - 3.1582.62-3.12282.54-3.27
ycf4+rbcL132.56 - 3.1582.75-3.31172.54-2.98

These findings suggest that the C-terminal domain of Ycf4 plays a particularly important role in mediating interactions with other chloroplast proteins, explaining why partial knockouts that preserve this region retain some functionality .

How do complete versus partial knockouts of Ycf4 differ in their impact on photosynthesis?

Research has revealed critical differences between complete and partial Ycf4 knockout phenotypes:

Complete knockout (deletion of all 184 amino acids):

  • Plants unable to survive photoautotrophically

  • Light green phenotype that progresses to pale yellow with age

  • Significant structural abnormalities in chloroplasts

  • Altered transcription of key photosynthetic genes

Partial knockout (deletion of 93 N-terminal amino acids):

  • Previously reported as a non-essential assembly factor for photosynthesis

  • Retained the C-terminal 91 amino acids which molecular docking studies show form numerous hydrogen bonds with photosynthetic proteins

  • Significantly less severe phenotype than complete knockout

What methodological approaches can reveal Ycf4's role beyond PSI assembly?

Transcriptome analysis provides crucial insights into Ycf4's broader functions beyond PSI assembly:

  • RNA sequencing of Δycf4 plants revealed that while expression of PSI, PSII, and ribosomal genes remained relatively unchanged, transcription levels of rbcL, LHC, and ATP synthase genes (atpB and atpL) were significantly decreased .

  • This pattern suggests Ycf4 has a regulatory role in plastid gene expression in addition to its assembly function .

  • Protein-protein interaction studies through molecular docking have shown that Ycf4 can interact with a wide range of photosynthetic proteins beyond PSI components, including ribosomal proteins, ATP synthase subunits, and carbon fixation enzymes .

These approaches demonstrate that comprehensive transcriptome analysis combined with protein interaction studies can reveal unexpected functions beyond the primary known role of assembly proteins.

How can researchers effectively verify the functional integrity of modified Ycf4 proteins?

When introducing modifications to Ycf4 (such as adding tags for purification), researchers should implement multiple validation approaches:

  • Fluorescence induction kinetics of dark-adapted cells to confirm PSI activity

  • Growth assays under photoautotrophic conditions (HSM medium) at various light intensities (50 μE·m⁻²·s⁻¹ to 1000 μE·m⁻²·s⁻¹)

  • Immunoblot analysis to compare PSI complex assembly between wild-type and modified strains

  • Transmission electron microscopy to examine chloroplast ultrastructure

  • Comparative transcriptome analysis of key photosynthetic genes

Using this multi-faceted approach ensures that modifications do not significantly impair Ycf4 function, which is particularly important when studying essential proteins where even subtle functional changes could have significant physiological impacts .

What are the optimal conditions for expressing and purifying recombinant Ycf4 for structural studies?

Based on successful purification protocols in the literature, researchers should consider:

  • Using a tandem affinity purification (TAP) tag strategy, which has proven effective for isolating intact Ycf4-containing complexes .

  • Solubilizing thylakoid membranes with appropriate detergents like dodecyl maltoside (DDM) to maintain complex integrity .

  • Implementing a two-step affinity chromatography approach, with longer incubation times (overnight at 4°C) to improve binding efficiency, as standard column flow-through may result in poor adsorption .

  • For structural studies, sucrose gradient ultracentrifugation followed by ion exchange chromatography can further purify the complex to homogeneity .

This approach has successfully yielded purified Ycf4-containing complexes suitable for transmission electron microscopy and single particle analysis .

How should researchers design knockout experiments to conclusively determine Ycf4 function?

Complete gene deletion is essential for definitive functional analysis of Ycf4:

  • Replace the entire ycf4 coding sequence with a selectable marker (such as aadA) through homologous recombination in the chloroplast genome .

  • Confirm complete replacement through both PCR and Southern blot analysis to verify homoplasmy .

  • Include controls to distinguish between direct effects of Ycf4 absence versus secondary effects:

    • Compare with wild-type plants under identical conditions

    • Include partial knockouts when possible to identify domain-specific functions

    • Perform complementation studies with the wild-type gene to confirm phenotype restoration

  • Assess multiple phenotypic parameters:

    • Photoautotrophic growth capability

    • Chloroplast ultrastructure

    • Transcriptome analysis

    • Protein complex assembly and accumulation

What controls are necessary when studying protein-protein interactions involving Ycf4?

When investigating Ycf4's interactions with other proteins, several controls are essential:

  • Input controls: Analysis of starting material before purification to confirm the presence of proteins of interest .

  • Negative controls: Parallel purification from wild-type or control strains lacking the affinity tag to identify non-specific binding .

  • Cross-validation: Confirmation of interactions through multiple independent methods:

    • Co-immunoprecipitation

    • Sucrose gradient ultracentrifugation

    • Ion exchange chromatography

    • Molecular docking predictions followed by experimental validation

  • Domain-specific analysis: Comparing interactions of full-length Ycf4 with truncated versions to map interaction domains .

  • Functional verification: Testing whether mutations that disrupt predicted interactions affect photosynthetic function .

This multi-layered approach ensures that identified interactions are specific, reproducible, and physiologically relevant to Ycf4's function in photosystem assembly.

How does Ycf4 function differ between cyanobacteria, green algae, and higher plants?

Comparative analysis reveals evolutionary differences in Ycf4 function:

  • In the green alga Chlamydomonas reinhardtii, Ycf4 is essential for PSI complex synthesis and/or stability .

  • In the higher plant tobacco (Nicotiana tabacum), complete knockout of Ycf4 prevents photoautotrophic growth, confirming its essential nature .

  • In contrast, cyanobacterial mutants deficient in Ycf4 can still assemble the PSI complex, albeit at a reduced level .

These differences suggest evolutionary adaptation of Ycf4's role, with increased functional importance in eukaryotic photosynthetic organisms compared to prokaryotic cyanobacteria. Methodologically, this requires researchers to be cautious when extrapolating findings between different photosynthetic lineages .

What techniques are most effective for comparing Ycf4 interaction networks across species?

For comparative interaction studies across species, researchers should employ:

  • Reciprocal BLAST analyses to identify true Ycf4 orthologs across diverse photosynthetic organisms .

  • Standardized TAP-tagging and affinity purification protocols applied consistently across species to allow direct comparison of interaction partners .

  • Comparative molecular docking analyses using protein models from different species to predict conservation of interaction interfaces .

  • Cross-species complementation studies to test functional conservation (e.g., can cyanobacterial Ycf4 complement a plant knockout?) .

  • Systematic analysis of hydrogen bonding patterns across different taxonomic groups to identify conserved versus species-specific interaction motifs .

This multi-faceted approach can reveal evolutionary conservation and divergence in Ycf4's interaction networks, providing insights into the functional adaptation of photosystem assembly mechanisms across photosynthetic lineages.

How might the interaction between Ycf4 and opsin-related COP2 influence photosystem assembly?

The intimate and exclusive association between Ycf4 and the opsin-related protein COP2 raises intriguing questions:

  • COP2, as a retinal-binding protein, may introduce light-sensing capabilities to the PSI assembly process, potentially allowing regulation of assembly in response to light conditions .

  • The copurification of COP2 with Ycf4 through multiple purification steps suggests a stable, functionally significant interaction rather than a transient association .

  • As part of a complex that includes newly synthesized PSI polypeptides, COP2 might facilitate the proper spatial arrangement of these components during assembly .

Future research should investigate whether the Ycf4-COP2 interaction is light-dependent and how it might coordinate PSI assembly with environmental light conditions. Specific assays comparing complex formation under different light regimes would provide valuable insights into this regulatory mechanism .

What is the molecular mechanism by which Ycf4 facilitates the initial assembly of PSI subunits?

Current evidence suggests a complex molecular mechanism:

  • Pulse-chase protein labeling experiments reveal that PSI polypeptides associated with the Ycf4-containing complex are newly synthesized and partially assembled .

  • Molecular docking studies show that Ycf4, particularly its C-terminal region, forms numerous hydrogen bonds with PSI subunits including PsaA, PsaB, PsaC, and PsaH .

  • The large size of the Ycf4-containing complex (>1500 kD) suggests it may function as a scaffold that brings together multiple PSI components in the correct orientation .

A proposed mechanistic model involves Ycf4 acting as both a recruitment platform for newly synthesized PSI subunits and a scaffold that facilitates their proper spatial arrangement and initial assembly, with the C-terminal domain playing a particularly crucial role in these protein-protein interactions .

What insights can chloroplast ultrastructural analysis provide about Ycf4's role in thylakoid membrane organization?

Transmission electron microscopy of Δycf4 plants reveals profound insights into Ycf4's broader functions:

These findings demonstrate that advanced electron microscopy techniques coupled with genetic manipulation can reveal unexpected structural roles for assembly factors like Ycf4, highlighting the interconnection between protein complex assembly and membrane architecture in chloroplasts .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.