Recombinant Prochlorococcus marinus subsp. pastoris Photosystem I reaction center subunit XI (psaL)

Shipped with Ice Packs
In Stock

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes if needed. We will fulfill requests to the best of our ability.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and agreed upon in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can be used as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a particular tag, please inform us, and we will prioritize its incorporation.
Synonyms
psaL; PMM1519; Photosystem I reaction center subunit XI; PSI subunit V; PSI-L
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-199
Protein Length
full length protein
Species
Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / NIES-2087 / MED4)
Target Names
psaL
Target Protein Sequence
MSDFQKSFSESTSSIKFDEKYIDNSVQPNDIGIANQWAVKPVSDPCVGNLATPVNSGYFT KAFINNLPFYREGISPNFRGLETGAAFGYLLYGPFSMTGPLRNSDFALTAGLLATIGAVH ILTGLLVLYNAPGKAPNVQPPDATVYNPPADLFTRTGWADFTSGFWLGGCGGAVFAWLLV GTLHLDTIMPIVKNIWTTG
Uniprot No.

Target Background

Database Links

KEGG: pmm:PMM1519

STRING: 59919.PMM1519

Protein Families
PsaL family
Subcellular Location
Cellular thylakoid membrane; Multi-pass membrane protein.

Q&A

How does the gene expression pattern of psaL compare to other Photosystem I components in Prochlorococcus?

The expression pattern of psaL in Prochlorococcus follows a diel rhythm similar to other PSI components but with distinct characteristics. Based on studies of related PSI genes such as psaB, Prochlorococcus shows a unique temporal expression pattern where transcript levels are typically lowest around noon and highest during the night period . This contrasts with Synechococcus, where PSI gene expression typically peaks in the afternoon (between 15:00-18:00). The psaL gene expression in Prochlorococcus is likely coordinated with other photosynthetic components but downregulated during high light periods as a protective mechanism against photodamage, reflecting the organism's adaptation to its ecological niche.

What cloning strategies are recommended for expressing recombinant psaL from Prochlorococcus marinus?

For successful cloning and expression of recombinant psaL from Prochlorococcus marinus subsp. pastoris, researchers should consider the following protocol:

  • Gene amplification: Use PCR with phosphorylated primers designed specifically for the psaL gene sequence, similar to the approach used for other Prochlorococcus genes .

  • Vector selection: Clone the amplified fragment between appropriate restriction sites (such as NcoI and HindIII) of an expression vector like pTrc99A .

  • Plasmid construction: Generate a construct containing the psaL gene and a downstream transcriptional terminator (such as rrnB).

  • Host selection: Transform into an appropriate host such as a glucose-uptake deficient cyanobacterial strain or E. coli optimized for membrane protein expression.

This methodology has proven effective for related Prochlorococcus proteins, as demonstrated in the recombinant expression of Pro1404 in Synechococcus elongatus PCC 7942 .

How do the structural characteristics of recombinant psaL impact Photosystem I assembly and function?

The recombinant psaL protein plays a crucial role in the assembly and structural integrity of Photosystem I, particularly in the formation of trimeric PSI complexes. X-ray crystallography studies of photosystem complexes have revealed that proper incorporation of psaL is essential for the correct positioning of chlorophyll molecules and stabilization of the protein-pigment architecture .

When expressing recombinant psaL, researchers should consider the following structural aspects:

Structural FeatureFunctionExperimental Consideration
Transmembrane helicesMembrane anchoring and inter-subunit interactionsMaintain hydrophobic domains integrity during purification
N-terminal domainSpecies-specific trimerization interfacePreserve native sequence for proper oligomerization
Pigment binding sitesCoordination of chlorophyll moleculesInclude cofactors during refolding procedures
Interface with psaA/psaBCore complex stabilizationCo-expression may improve folding and stability

Improper folding or processing of recombinant psaL can disrupt the precise arrangement of the 156 chlorophyll molecules and 32 carotenoids normally found in the PSI-LHCI supercomplex . For functional studies, researchers should validate proper incorporation of psaL using circular dichroism spectroscopy and pigment binding analysis.

What are the differences in expression systems for producing functional recombinant psaL protein?

The choice of expression system significantly impacts the yield and functionality of recombinant psaL protein. Based on experimental approaches with other photosynthetic proteins, researchers should consider:

  • Cyanobacterial hosts:

    • Advantages: Native-like membrane environment, correct post-translational modifications, proper cofactor insertion

    • Challenges: Lower yields, longer cultivation time, genetic manipulation complexity

    • Example method: Transformation into Synechococcus elongatus PCC 7942 using kanamycin resistance cassettes like C.K1 or C.K3 with different promoter strengths

  • E. coli-based expression:

    • Advantages: Rapid growth, high yield, well-established protocols

    • Challenges: Inclusion body formation, improper folding, lack of cofactors

    • Recommended approach: Use specialized strains like C41(DE3) with cold-induction and membrane-targeting sequences

  • Cell-free expression systems:

    • Advantages: Direct synthesis without cellular constraints, rapid screening capability

    • Challenges: Lower yields, higher cost, complex reconstitution of membrane environment

For optimal functional characterization, recombinant psaL should be expressed in conjunction with its native interaction partners. Expression in cyanobacterial hosts often yields lower protein quantities but with higher functional integrity, making this approach preferable for structural and functional studies.

How can researchers assess the proper integration and function of recombinant psaL in reconstituted Photosystem I complexes?

Validating the proper integration and functionality of recombinant psaL in reconstituted PSI complexes requires multiple analytical approaches:

  • Spectroscopic analysis:

    • Measure absorption spectra between 400-700 nm to verify characteristic PSI peaks

    • Perform 77K fluorescence emission spectroscopy to assess energy transfer efficiency

    • Circular dichroism spectroscopy to confirm secondary structure integrity

  • Functional assays:

    • Oxygen evolution/consumption measurements using Clark-type electrodes

    • P700 photooxidation kinetics using pulse amplitude modulated fluorometry

    • Electron transport rates using artificial electron acceptors (methyl viologen)

  • Structural validation:

    • Blue-native PAGE to assess complex formation and oligomeric state

    • Size-exclusion chromatography coupled with multi-angle light scattering

    • Electron microscopy to verify trimeric arrangement in membrane environments

A robust analytical framework should include these complementary approaches to confirm that the recombinant psaL is properly incorporated and functional. Researchers should compare results with native PSI preparations as controls, noting that proper PSI assembly with recombinant components should maintain the precise arrangement of the numerous cofactors (>200 molecules) typically found in the complete PSI-LHCI supercomplex .

What purification strategies maximize yield and stability of recombinant psaL protein?

Purifying recombinant psaL protein presents unique challenges due to its hydrophobic nature and requirement for maintaining structural integrity. Based on successful approaches with similar photosynthetic proteins, a recommended purification protocol includes:

  • Membrane fraction isolation:

    • Cell disruption by French press or sonication in buffer containing 50 mM Tris-HCl pH 7.5, 10 mM MgCl₂

    • Sequential centrifugation: low-speed (10,000 g, 10 min) to remove cell debris, followed by high-speed ultracentrifugation (150,000 g, 1 hour) to collect membranes

  • Solubilization optimization:

    • Screen multiple detergents at varying concentrations:

    DetergentOptimal ConcentrationAdvantagesLimitations
    β-DDM1.0% (w/v)Mild, preserves PSI activityLarger micelles
    α-DDM0.5% (w/v)Enhanced stabilityModerate extraction efficiency
    LDAO0.05% (w/v)High extraction efficiencyPotential destabilization
    Digitonin1-2% (w/v)Preserves supercomplexesLower yield
  • Chromatographic separation:

    • Immobilized metal affinity chromatography (if His-tagged)

    • Ion exchange chromatography (using a salt gradient of 0-500 mM NaCl)

    • Size exclusion chromatography for final polishing and buffer exchange

  • Stability considerations:

    • Maintain 0.03-0.05% detergent in all buffers to prevent aggregation

    • Include glycerol (10-20%) to enhance stability during storage

    • Store purified protein at -80°C in single-use aliquots with cryoprotectants

The purification protocol should be validated by SDS-PAGE, western blotting with psaL-specific antibodies, and mass spectrometry to confirm protein identity and purity. Researchers should expect yields of 0.1-0.5 mg of purified psaL protein per liter of cyanobacterial culture or 1-3 mg per liter of E. coli culture.

How can researchers optimize site-directed mutagenesis protocols for studying structure-function relationships in psaL?

Site-directed mutagenesis of psaL provides valuable insights into structure-function relationships within the PSI complex. An optimized protocol for psaL mutagenesis should include:

  • Target selection strategy:

    • Prioritize conserved residues identified through multi-sequence alignment of psaL across cyanobacterial species

    • Focus on residues at interfaces with other PSI subunits (particularly psaA and psaB)

    • Target residues involved in chlorophyll coordination or carotenoid binding

  • Mutagenesis method optimization:

    • For multiple mutations, use overlap extension PCR with phosphorylated primers

    • For single mutations, employ a QuikChange-type approach with high-fidelity polymerases

    • Design primers with the mutation centered and 15-20 complementary nucleotides on each side

  • Verification procedures:

    • Sequence entire psaL gene to confirm desired mutation and absence of unintended changes

    • Verify protein expression levels by western blot before functional characterization

    • Assess proper folding using circular dichroism spectroscopy

  • Functional impact analysis:

    • Compare PSI trimer formation efficiency between wild-type and mutant psaL

    • Measure energy transfer kinetics to identify perturbations in excitation energy pathways

    • Assess electron transport rates from P700 to ferredoxin in reconstituted systems

When interpreting mutagenesis results, researchers should consider the integrated nature of the PSI complex, where subtle structural changes may have far-reaching functional consequences. The extensive pigment network within PSI (containing more than 200 prosthetic groups including 156 chlorophylls) means that alterations to psaL can affect energy transfer pathways beyond its immediate structural vicinity .

How does the psaL subunit contribute to Prochlorococcus' adaptation to different light environments?

The psaL subunit plays a crucial role in Prochlorococcus' remarkable adaptation to varying light intensities in the marine environment. Unlike Synechococcus, which exhibits more robust light stress responses, Prochlorococcus demonstrates higher sensitivity to high light and UV exposure . The psaL protein contributes to this ecological adaptation through:

  • Structural modifications:

    • Prochlorococcus psaL exhibits sequence adaptations that optimize PSI trimerization in low-light environments

    • These modifications enhance light-harvesting efficiency by optimizing chlorophyll orientation

  • Interaction with light-harvesting systems:

    • Instead of phycobilisomes used by Synechococcus, Prochlorococcus psaL interacts with the Pcb (prochlorophyte chlorophyll-binding) proteins

    • This interaction is critical as the pcbA gene shows a similar diel expression pattern to PSI genes in Prochlorococcus, with downregulation during high light periods

  • Contribution to stress responses:

    • The psaL subunit helps maintain PSI stability during oxidative stress conditions

    • Its structure-function relationship differs from Synechococcus counterparts, reflecting divergent evolutionary strategies

Research indicates that high-light and low-light adapted ecotypes of Prochlorococcus show differences in their psaL sequences and expression patterns, contributing to their distinct ecological niches. These adaptations represent an evolutionary trade-off, sacrificing resistance to high irradiance for enhanced efficiency in light-limited conditions typical of deeper oceanic waters.

What insights can comparative analysis of psaL sequences provide about photosystem evolution in marine cyanobacteria?

Comparative analysis of psaL sequences across marine cyanobacterial lineages reveals important evolutionary insights:

  • Phylogenetic relationships:

    • psaL sequence analysis complements 16S rRNA-based phylogenies, providing specific information about photosynthetic adaptation

    • Sequence divergence patterns indicate that psaL evolution has been driven by light regime adaptations

  • Selection pressures:

    • Regions involved in trimerization show different conservation patterns between Prochlorococcus and Synechococcus

    • Coastal vs. open ocean isolates display characteristic sequence variations reflecting their light environments

  • Functional divergence:

    FeatureProchlorococcus psaLSynechococcus psaLEvolutionary Implication
    Transmembrane regionsMore hydrophobicLess hydrophobicAdaptation to different membrane compositions
    Chlorophyll-binding motifsOptimized for divinyl-Chl a/bAdapted for interaction with phycobilisomesDivergent light-harvesting strategies
    Trimer interfaceModified for enhanced stabilityStandard cyanobacterial arrangementLow-light specialization in Prochlorococcus
  • Co-evolution with other components:

    • psaL sequence changes correlate with modifications in psaA, psaB, and light-harvesting proteins

    • These coordinated changes reflect the integrated nature of the photosynthetic apparatus evolution

This comparative approach provides a molecular window into the divergent strategies that emerged when Prochlorococcus and Synechococcus lineages adapted to different oceanic light niches. While Synechococcus developed mechanisms to cope efficiently with light and UV stress, Prochlorococcus optimized its photosynthetic apparatus (including psaL) for maximum efficiency in stable, low-light environments .

What controls and validation experiments are essential when expressing recombinant psaL protein?

When expressing recombinant psaL protein, researchers should implement the following controls and validation experiments:

  • Expression controls:

    • Positive control: Express a well-characterized membrane protein using the same system

    • Negative control: Transform host with empty vector to assess background expression

    • Host strain control: Use a strain deficient in native psaL (for cyanobacterial hosts) to prevent contamination

  • Functional validation assays:

    • PSI assembly assessment: Blue-native PAGE to determine if recombinant psaL facilitates proper complex formation

    • Spectroscopic validation: Compare absorption and fluorescence spectra with native PSI preparations

    • Electron transport measurements: Assess if reconstituted complexes with recombinant psaL support electron flow from P700 to ferredoxin

  • Structural verification:

    • Circular dichroism to confirm secondary structure integrity

    • Limited proteolysis to verify proper folding and domain organization

    • Analytical ultracentrifugation to assess oligomerization state

  • Biochemical validation:

    • Chlorophyll binding assay to confirm proper pigment incorporation

    • Co-immunoprecipitation with other PSI subunits to verify interaction capability

    • Mass spectrometry to confirm protein identity and detect any post-translational modifications

When designing these controls, researchers should consider the approach used for other Prochlorococcus proteins, such as the Pro1404 transporter, where recombinant strains expressing the protein were compared against both positive controls (Synechocystis sp. PCC 6803) and negative controls (S. elongatus recombinant strain with a cassette insertion) . This comprehensive validation framework ensures that the recombinant psaL protein accurately represents the native protein's properties.

How can researchers troubleshoot common challenges in recombinant psaL expression and purification?

Researchers frequently encounter specific challenges when working with recombinant psaL. Here are structured troubleshooting approaches for common issues:

  • Low expression yield:

    • Problem: Poor protein accumulation despite confirmed gene presence

    • Diagnostic steps: Verify mRNA levels by RT-PCR; monitor protein expression at different timepoints

    • Solutions: Optimize codon usage for host organism; test different promoter strengths (e.g., C.K1 vs. C.K3 cassettes) ; adjust cultivation temperature to 18-22°C during induction

  • Protein misfolding and aggregation:

    • Problem: Recombinant psaL forms inclusion bodies or aggregates

    • Diagnostic steps: Compare soluble vs. insoluble fractions by western blot; assess temperature dependence of aggregation

    • Solutions: Co-express molecular chaperones; include stabilizing agents (glycerol, specific lipids); optimize detergent type and concentration during extraction

  • Poor complex integration:

    • Problem: Recombinant psaL fails to incorporate into PSI complexes

    • Diagnostic steps: Analyze complex formation by BN-PAGE; perform pull-down assays with other PSI subunits

    • Solutions: Co-express with interacting partners; ensure proper chlorophyll availability during expression; optimize reconstitution buffer conditions

  • Loss of function after purification:

    • Problem: Purified protein loses structural integrity or function

    • Diagnostic steps: Monitor spectroscopic properties during purification steps; perform activity assays at each stage

    • Solutions: Minimize exposure to light and oxidizing conditions; maintain constant detergent concentration above CMC; add stabilizing lipids to purification buffers

  • Experimental validation table:

    ProblemDiagnostic ApproachPotential SolutionsSuccess Indicator
    No PCR amplification of psaLTest primer efficiency; optimize PCR conditionsRedesign primers; use specialized polymerases for GC-rich templatesClean band at expected size
    Poor transformation efficiencyVerify competent cell viabilityOptimize transformation protocol; use electroporationIncreased colony number
    Toxic expression effectsMonitor growth curves with/without inductionUse tightly regulated promoters; lower induction temperatureNormal growth after induction
    Protein degradationTime-course western blot analysisAdd protease inhibitors; express in protease-deficient strainsStable protein band over time

By systematically addressing these challenges, researchers can improve the likelihood of successful recombinant psaL production, similar to the strategies employed for other Prochlorococcus membrane proteins .

How can researchers investigate the interaction between recombinant psaL and other Photosystem I components?

Understanding the interactions between recombinant psaL and other PSI components requires sophisticated biochemical and biophysical approaches:

  • Crosslinking mass spectrometry (XL-MS):

    • Apply chemical crosslinkers (e.g., BS3, DSS, or EDC) to stabilize protein-protein interactions

    • Digest crosslinked complexes and analyze by LC-MS/MS

    • Identify interaction interfaces between psaL and adjacent subunits (particularly psaA, psaB, and psaI)

  • Surface plasmon resonance (SPR):

    • Immobilize purified recombinant psaL on sensor chips

    • Measure real-time binding kinetics with other purified PSI subunits

    • Determine association/dissociation constants for each interaction

  • Native mass spectrometry:

    • Analyze intact PSI complexes containing recombinant psaL

    • Determine stoichiometry and stability of interactions

    • Compare complex formation efficiency with native vs. recombinant psaL

  • Förster resonance energy transfer (FRET):

    • Introduce fluorescent labels at specific sites in psaL and partner proteins

    • Measure energy transfer efficiency to map spatial relationships

    • Develop distance constraints for structural modeling

  • Cryo-electron microscopy:

    • Image reconstituted PSI complexes containing recombinant psaL

    • Generate 3D reconstructions to visualize the integration of psaL

    • Compare with existing high-resolution structures of PSI-LHCI complexes

These methods provide complementary information about the structural role of psaL in the PSI complex. Researchers should note that PSI contains over 200 prosthetic groups , and proper psaL incorporation is essential for maintaining the precise arrangement of these cofactors, particularly the chlorophylls and carotenoids at the interface between psaL and adjacent subunits.

What computational approaches can predict the impact of psaL mutations on Photosystem I structure and function?

Computational methods offer powerful tools for predicting how mutations in psaL might affect PSI structure and function:

  • Molecular dynamics simulations:

    • Generate atomistic models of wild-type and mutant psaL within the PSI complex

    • Simulate protein dynamics in membrane environments for 100-500 ns

    • Analyze conformational changes, hydrogen bonding networks, and stability differences

  • Quantum mechanical calculations:

    • Model electronic properties of chlorophylls coordinated by psaL residues

    • Predict changes in excitation energy transfer pathways

    • Calculate how mutations affect redox properties of nearby cofactors

  • Evolutionary coupling analysis:

    • Identify co-evolving residue pairs in psaL and interaction partners

    • Predict critical residues at subunit interfaces

    • Assess conservation patterns across cyanobacterial lineages

  • Machine learning approaches:

    • Train neural networks on existing PSI structural data

    • Predict stability changes (ΔΔG) upon mutation

    • Classify mutations as benign or disruptive to PSI assembly

  • Network analysis of energy transfer pathways:

    • Model the chlorophyll network within PSI as a graph

    • Simulate excitation energy transfer with modified psaL

    • Identify potential bottlenecks or alterations in energy flow

When applying these methods, researchers should integrate structural data from high-resolution PSI models with experimental validation. The computational predictions can guide experimental design by identifying the most informative mutations for subsequent biochemical and biophysical characterization.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.