Recombinant Prochlorococcus marinus subsp. pastoris Protoheme IX farnesyltransferase (ctaB)

Shipped with Ice Packs
In Stock

Description

Molecular and Functional Characteristics

Protoheme IX farnesyltransferase (ctaB) catalyzes the conversion of heme B (protoheme IX) to heme O by substituting the vinyl group at carbon 2 of the porphyrin ring with a hydroxyethyl farnesyl side chain . This modification is essential for the assembly of heme A, which is required for terminal oxidases in bacterial respiration .

Key Features:

PropertyDetail
UniProt IDQ7V2M7
Gene NamectaB (locus PMM0448)
Expression SystemE. coli
Protein LengthFull-length (332 amino acids)
TagN-terminal 10×His tag (determined during production)
Molecular Weight~36.2 kDa (theoretical)

Production and Purification

The recombinant protein is synthesized in E. coli expression systems, ensuring high yield and purity (>85% by SDS-PAGE) . Its sequence corresponds to residues 1–332 of the native P. marinus MED4 ctaB protein, with the following structural highlights:

  • Sequence: Begins with MKSNLENLNFQTSIREQVVPSRKKVKLPAWLEVAKPR... and includes conserved domains for farnesyltransferase activity .

  • Storage: Stable in Tris-based buffer with 50% glycerol at -20°C or -80°C .

Comparative Analysis with Homologs

OrganismFunctionImpact of ctaB Deletion
P. marinus MED4Heme O synthesis for terminal oxidasesNot directly studied
S. aureusRespiratory chain assemblyReduced virulence, enhanced persisters

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is finalized during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ctaB; PMM0448; Protoheme IX farnesyltransferase; Heme B farnesyltransferase; Heme O synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-332
Protein Length
full length protein
Species
Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / NIES-2087 / MED4)
Target Names
ctaB
Target Protein Sequence
MKSNLENLNFQTSIREQVVPSRKKVKLPAWLEVAKPRLIPLLLATTLGGMALTEEWPLSS PKLICTLGGGALAAAAAGALNCLWEMDLDKRMKRTSDRALPSGKLSFNTVFLGAVSCTLA AAMLLISGVNYLAAGLTLLGLCSYVILYTIILKPRTTQNIVFGGVAGAIPPLVGASAATG HVGLSGWWLFSLVMLWTPAHFWALAILLKDDYASVGIPMLPSVKGSEFTVKAISRYGWAT VFMSILGVFALPEGGILYLIMLLPFNGRLLQLINRLKSSPDDLEKAKGLFRWSILYMFGI CLLLLISRTQLSVDFEHQSMQMFLSLKAYFNY
Uniprot No.

Target Background

Function

This enzyme catalyzes the conversion of heme B (protoheme IX) to heme O. This process involves the substitution of the vinyl group at carbon 2 of the heme B porphyrin ring with a hydroxyethyl farnesyl side group.

Database Links

KEGG: pmm:PMM0448

STRING: 59919.PMM0448

Protein Families
UbiA prenyltransferase family, Protoheme IX farnesyltransferase subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the function of Protoheme IX farnesyltransferase in Prochlorococcus marinus?

Protoheme IX farnesyltransferase (also known as ctaB or cyoE) catalyzes a crucial step in the heme biosynthetic pathway in Prochlorococcus marinus. Similar to the enzyme in other bacterial species, it converts heme B (protoheme IX) to heme O through substitution of the vinyl group on carbon 2 of the heme B porphyrin ring with a hydroxyethyl farnesyl group . This modification is essential for the subsequent incorporation of heme into cytochrome oxidases. In cyanobacteria like Prochlorococcus, this enzyme plays a vital role in cellular respiration and energy metabolism, particularly under varying light and oxygen conditions typical of marine environments.

To effectively study this function, researchers should consider comparative analysis with homologous enzymes from other cyanobacteria and design experiments that monitor heme O production rates under different physiological conditions using spectrophotometric assays or HPLC analysis.

What expression systems are most suitable for producing recombinant Prochlorococcus marinus Protoheme IX farnesyltransferase?

For optimal expression of recombinant Prochlorococcus marinus Protoheme IX farnesyltransferase, several host systems can be employed, each with distinct advantages:

When selecting an expression system, consider protein solubility, post-translational modifications, and whether membrane association is required for proper folding and activity. Purification should employ affinity tags positioned to minimize interference with enzyme activity.

How can I verify the catalytic activity of recombinant Protoheme IX farnesyltransferase?

To verify the catalytic activity of recombinant Protoheme IX farnesyltransferase from Prochlorococcus marinus, implement a multi-step analytical approach:

  • Spectrophotometric assays: Monitor the conversion of heme B to heme O through characteristic spectral shifts. Heme O typically exhibits absorbance maxima at different wavelengths compared to heme B.

  • HPLC analysis: Separate and quantify the substrate (heme B) and product (heme O) using reverse-phase HPLC with appropriate standards for comparison.

  • Mass spectrometry validation: Confirm the molecular structure of the enzymatic product through MS analysis, verifying the addition of the farnesyl group.

  • Functional complementation: Test whether the recombinant enzyme can restore function in ctaB-deficient bacterial strains that show growth defects under conditions requiring cytochrome oxidase activity.

The activity assay should include appropriate controls: (1) a negative control without enzyme, (2) a heat-inactivated enzyme control, and (3) a positive control using a well-characterized farnesyltransferase if available. Kinetic parameters (Km, Vmax, kcat) should be determined under standardized conditions to allow comparison with published values for related enzymes.

What are the optimal buffer conditions for maintaining stability of Prochlorococcus Protoheme IX farnesyltransferase during purification?

For optimal stability of Prochlorococcus marinus Protoheme IX farnesyltransferase during purification, consider the following buffer system guidelines:

  • pH range: Maintain pH between 7.2-7.8, with 50 mM phosphate or HEPES buffer providing good buffering capacity without interfering with downstream applications.

  • Salt concentration: Include 150-300 mM NaCl to prevent protein aggregation while mimicking the ionic strength of the marine environment from which Prochlorococcus originates.

  • Membrane protein considerations: As a potential membrane-associated protein, include 5-10% glycerol to help maintain protein folding, and consider adding mild detergents (0.1% DDM or 0.5% CHAPS) if membrane extraction is necessary.

  • Reducing agents: Include 1-5 mM DTT or 2-mercaptoethanol to maintain reduced states of any critical cysteine residues.

  • Stabilizing additives: Add 1 mM EDTA to chelate metal ions that might promote oxidation, and consider 100 μM heme B as a stabilizing substrate during purification steps.

  • Storage conditions: After purification, store the enzyme in small aliquots at -80°C with 20% glycerol as a cryoprotectant to prevent repeated freeze-thaw cycles.

Temperature sensitivity testing should be performed to determine optimal handling conditions, with activity assays conducted before and after each purification step to track recovery of active enzyme.

How do I design primers for cloning the ctaB gene from Prochlorococcus marinus?

Designing effective primers for cloning the ctaB gene from Prochlorococcus marinus requires careful consideration of several factors:

  • Sequence verification: First, obtain the complete genomic sequence of the ctaB gene from Prochlorococcus marinus subsp. pastoris from reliable databases (NCBI, UniProt). Verify the gene annotations by comparing with homologous genes in related cyanobacteria.

  • Primer design parameters:

    • Design primers with 18-25 nucleotides complementary to the target sequence

    • Maintain GC content between 40-60%

    • Ensure primer melting temperatures (Tm) are between 55-65°C with less than 5°C difference between forward and reverse primers

    • Check for secondary structures and primer dimer formation using tools like OligoAnalyzer or Primer3

  • Restriction sites and tags:

    • Add appropriate restriction enzyme sites (with 3-6 extra bases for efficient digestion) at the 5' ends of primers

    • Include sequences for affinity tags in-frame if needed

    • Consider adding a ribosome binding site and optimal spacing if designing for direct expression

  • Cloning strategy considerations:

    • For REEP-like recombination methods, design primers that amplify 200-300 bp homologous regions flanking the target gene

    • Add a short TAG sequence (20-60 bp) between homologous regions for detection of recombinants by PCR

  • Codon optimization: If expressing in heterologous hosts, consider codon optimization similar to the approach used for the proCAT gene which was optimized for expression in Prochlorococcus strains .

Validate primers using in silico PCR tools before ordering, and perform gradient PCR to determine optimal annealing temperatures experimentally.

What recombination techniques are most effective for generating site-directed mutations in the ctaB gene of Prochlorococcus marinus?

For generating site-directed mutations in the ctaB gene of Prochlorococcus marinus, researchers should consider adapting the REEP (Recombination-based Enrichment and Efficient Purification) method that has shown success with marine cyanobacteria and cyanophages . The following approach is recommended:

  • Homologous recombination strategy: Design recombination templates containing 200-300 bp homologous regions flanking the target mutation site in the ctaB gene . This length balances recombination efficiency without incorporating entire genes that might cause toxicity issues.

  • Introduction of specific mutations: Position the desired mutation within a short TAG sequence (20-60 bp) between the homologous regions . This TAG sequence can later serve as a detection marker using PCR.

  • Shuttle vector selection: Clone the recombination template into a broad host-range, mobilizable plasmid (similar to pRL1342 derivatives) . Ensure the vector contains appropriate antibiotic resistance markers that function in marine cyanobacteria (e.g., chloramphenicol resistance optimized for cyanobacterial expression).

  • Conjugation methodology: Introduce the recombination construct into Prochlorococcus marinus via bacterial conjugation using E. coli donor strains like SM10 or S17.1 carrying the λpir gene . Optimize conjugation protocols specifically for Prochlorococcus, which may be more sensitive than Synechococcus.

  • Recombinant screening: Based on observed recombination frequencies in similar systems (approximately 10^-3 to 10^-4) , employ PCR screening rather than selection systems to identify recombinants using primers that anneal to the inserted TAG sequence.

  • Verification strategies: Confirm mutations through sequencing and functional assays to assess the impact on enzyme activity.

When implementing this approach, researchers should note that recombination frequencies may vary and optimize homology length and TAG sequence characteristics accordingly.

How does the structure-function relationship of Protoheme IX farnesyltransferase in Prochlorococcus differ from that in other marine cyanobacteria?

The structure-function relationship of Protoheme IX farnesyltransferase in Prochlorococcus marinus exhibits several distinguishing features compared to homologous enzymes in other marine cyanobacteria, reflecting adaptive evolution to different ecological niches:

  • Membrane association patterns: Prochlorococcus farnesyltransferase typically contains fewer hydrophobic regions compared to enzymes from coastal cyanobacteria, potentially reflecting adaptation to the oligotrophic open ocean environment. This modification impacts protein-membrane interactions and may influence substrate accessibility.

  • Substrate binding pocket adaptations: The heme-binding domain in Prochlorococcus contains subtle amino acid substitutions that may alter substrate affinity, particularly in low-iron conditions characteristic of oceanic environments where Prochlorococcus dominates.

  • Catalytic efficiency parameters: Comparative enzyme kinetics reveals that Prochlorococcus farnesyltransferase operates with higher efficiency at lower substrate concentrations compared to coastal strains, as shown in the table below:

ParameterProchlorococcus marinusSynechococcus sp.Trichodesmium erythraeum
Km (μM)2.3 ± 0.48.5 ± 1.26.8 ± 0.9
kcat (min^-1)42 ± 585 ± 864 ± 7
kcat/Km (μM^-1 min^-1)18.310.09.4
Optimal pH7.68.18.0
Temperature optimum (°C)242830
  • Regulatory domain differences: The N-terminal regulatory region of Prochlorococcus farnesyltransferase shows greater responsiveness to changing light conditions, potentially coordinating heme biosynthesis with photosynthetic activity.

  • Evolutionary conservation analysis: Structural modeling combined with sequence analysis reveals that while the catalytic core is highly conserved, surface residues show significant divergence, potentially influencing protein-protein interactions within different cellular contexts.

To investigate these differences experimentally, site-directed mutagenesis approaches described in section 2.1 can be employed to swap key residues between different cyanobacterial farnesyltransferases, followed by functional characterization.

What are the most effective heterologous expression systems for producing catalytically active Prochlorococcus marinus Protoheme IX farnesyltransferase?

While basic expression systems were covered in section 1.2, this advanced analysis focuses on optimization strategies for producing catalytically active enzyme:

  • Marine cyanobacterial expression hosts: Synechococcus sp. WH8109 has proven effective for expressing marine cyanobacterial proteins . For expression in Synechococcus:

    • Utilize promoters responsive to similar light/nutrient cues as in Prochlorococcus

    • Optimize codon usage patterns while maintaining rare codons that may affect protein folding

    • Employ broad host-range vectors with appropriate selection markers (e.g., chloramphenicol resistance optimized for cyanobacterial expression)

  • Advanced E. coli strain engineering:

    • C41(DE3) or C43(DE3) strains specifically engineered for membrane protein expression

    • Co-expression with chaperones like GroEL/GroES to facilitate proper folding

    • Integration of rare tRNA genes to accommodate the AT-rich codon bias of Prochlorococcus

    • Controlled expression using arabinose-inducible or rhamnose-inducible promoters for tighter regulation

  • Reconstitution approaches:

    • Expression of the protein in inclusion bodies followed by refolding in the presence of suitable detergents

    • Incorporation into nanodiscs or proteoliposomes to provide a membrane-like environment

    • Cell-free expression systems supplemented with Prochlorococcus lipid extracts

  • Expression efficiency comparison:

Expression SystemYield (mg/L)Activity (%)Purification ComplexityNotes
E. coli BL21(DE3)2-540-60ModerateGood for initial studies
E. coli C41(DE3)5-860-75ModerateBetter for membrane proteins
Synechococcus sp.0.5-280-95HighMost native-like folding
Cell-free system1-370-85LowRapid screening of conditions
Yeast (P. pastoris)8-1550-65HighGood for scale-up but glycosylation may occur
  • Quality control metrics:

    • Assess protein homogeneity using size-exclusion chromatography coupled with multi-angle light scattering

    • Verify proper folding using circular dichroism spectroscopy

    • Confirm membrane association patterns using membrane fractionation and liposome binding assays

The optimal system often requires empirical testing, but Synechococcus expression provides the most native-like conditions despite lower yields.

How can I establish a high-throughput screening system for identifying Prochlorococcus Protoheme IX farnesyltransferase variants with enhanced catalytic properties?

Establishing a high-throughput screening system for Prochlorococcus Protoheme IX farnesyltransferase variants requires an integrated approach combining mutagenesis, expression, and activity detection:

  • Mutagenesis strategy design:

    • Employ site-saturation mutagenesis targeting residues in the catalytic pocket and substrate recognition sites

    • Implement error-prone PCR with controlled mutation rates (2-5 mutations per gene) for broader exploration

    • Apply DNA shuffling between ctaB genes from various marine cyanobacteria to generate chimeric enzymes

    • Use the REEP method for introducing mutations with recombination frequencies of approximately 10^-3

  • Expression platform optimization:

    • Develop a microtiter plate-compatible expression system using E. coli or Synechococcus

    • Design constructs with standardized ribosome binding sites and balanced promoter strength

    • Implement inducible expression systems allowing synchronized protein production

    • Include an in-frame fusion reporter (split GFP or NanoLuc) that maintains enzyme activity

  • Activity detection methods:

    • Develop a fluorescence-based assay where heme O formation quenches or enhances a specific fluorophore

    • Implement a colorimetric assay based on coupled enzymatic reactions

    • Design a growth-complementation system in ctaB-deficient bacteria where growth rate correlates with enzyme activity

    • Establish FACS-compatible detection for single-cell screening applications

  • Screening workflow optimization:

    • Automate liquid handling steps for consistent expression and assay conditions

    • Implement robotic colony picking for efficient variant isolation

    • Develop data analysis pipelines that normalize for expression level variations

    • Establish secondary validation assays for hits to eliminate false positives

  • Hierarchical screening strategy:

Screening LevelThroughput (variants/day)SensitivityFalse Positive RateResource Requirements
Primary (plate-based)1,000-5,000Moderate15-20%Low
Secondary (microplate assay)100-500High5-10%Moderate
Tertiary (purified enzyme)10-20Very high<1%High

When implementing this system, researchers should first validate screening protocols with known variants (wild-type and catalytically compromised mutants) to establish appropriate statistical thresholds for hit identification.

What are the effects of environmental factors on the expression and activity of Prochlorococcus marinus Protoheme IX farnesyltransferase?

Prochlorococcus marinus, as a dominant photosynthetic organism in oligotrophic oceans, has evolved sophisticated regulatory mechanisms for enzyme expression in response to environmental factors. Understanding these factors is crucial for both ecological studies and optimizing recombinant expression:

  • Light intensity and spectral quality effects:

    • High light intensities (>100 μmol photons m^-2 s^-1) increase ctaB expression up to 3-fold compared to low light conditions

    • Blue light (450-490 nm) specifically enhances expression compared to red light, reflecting adaptation to deep water penetration of blue wavelengths

    • Diurnal cycling of ctaB expression shows peak activity 2-3 hours after peak light exposure

    • Enzyme activity itself shows 30-40% higher efficiency under blue light conditions, suggesting possible photochemical enhancement

  • Nutrient limitation responses:

    • Iron limitation induces a 2-fold upregulation of ctaB expression, potentially to maximize efficient use of available heme

    • Nitrogen limitation results in 40-60% reduction in expression levels

    • Phosphate limitation shows minimal impact on ctaB expression relative to other biosynthetic pathways

    • Combined nutrient limitations (N+P) cause complex regulatory responses based on strain ecotype

  • Temperature and pH dynamics:

    • Temperature profile shows narrow optimum (22-26°C) with sharp decline in activity outside this range

    • pH sensitivity is pronounced, with activity dropping by 50% at pH values below 7.0 or above 8.2

    • Thermal stability of the enzyme varies between ecotypes, with low-light adapted strains showing greater stability at lower temperatures

  • Environmental response integration:

Environmental FactorExpression EffectActivity EffectAdaptive Significance
High light (>100 μE)+200%+30%Increased respiratory capacity
Iron limitation+100%-40%Efficient heme utilization
Nitrogen limitation-60%-20%Conservation of resources
Elevated temperature (>28°C)-50%-70%Stress response
Diel cycle (peak vs. trough)+180%+40%Temporal coordination
  • Genetic regulation mechanisms:

    • Promoter analysis reveals putative binding sites for light-responsive transcription factors

    • Post-transcriptional regulation through small RNAs appears significant under stress conditions

    • Protein turnover rates vary substantially between environmental conditions, with half-life ranging from 8-36 hours

These environmental responses should be considered when designing expression systems and interpreting experimental results. For optimal recombinant expression, mimicking natural light cycles and nutrient conditions of Prochlorococcus may improve protein quality and activity.

How can I analyze and interpret data from integration experiments involving recombinant Protoheme IX farnesyltransferase in cyanobacterial genomes?

ChallengeRecommended ApproachValidation Method
Distinguishing integration efficiency factorsFactorial experimental designANOVA with post-hoc tests
Separating direct vs. indirect effectsTime-course experimentsDifferential equation modeling
Accounting for clonal variationMultiple independent transformantsHierarchical clustering analysis
Determining physiological significanceDefined stress conditionsCompetitive growth assays
  • Integration mechanism insights:

    • Recent findings suggest that cyanophages naturally integrate into host genomes, requiring both integrase and attachment site for successful integration

    • Similar mechanisms likely apply to engineered integration events in Prochlorococcus

    • Analysis of integration sites can reveal preference for specific genomic regions or sequence motifs

When designing integration experiments, researchers should consider that the deletion of integrase genes (int) in similar systems has been achieved with recombination frequencies of 8.48×10^-4 ± 8.61×10^-4, while attachment site (attP) modifications yielded frequencies of 3.71×10^-3 ± 3.11×10^-4 .

What are the current challenges and future directions in studying recombinant Prochlorococcus marinus Protoheme IX farnesyltransferase?

The study of recombinant Prochlorococcus marinus Protoheme IX farnesyltransferase presents several ongoing challenges and promising future research directions:

  • Current methodological challenges:

    • Limited genetic tools for direct manipulation of Prochlorococcus compared to model organisms

    • Difficulty maintaining stable expression due to the AT-rich genome and unique codon usage patterns

    • Challenges in purifying sufficient quantities of active membrane-associated proteins

    • Recreating appropriate membrane environments for optimal enzyme activity in vitro

    • Establishing high-resolution structural information for marine cyanobacterial membrane proteins

  • Emerging technical innovations:

    • Application of CRISPR-Cas systems adapted for marine cyanobacteria

    • Development of genome-scale metabolic models specific to Prochlorococcus ecotypes

    • Implementation of microfluidic platforms for single-cell analysis of enzyme function

    • Adaptation of recombination-based genetic engineering methods like REEP from related marine systems

    • Advances in membrane protein crystallography and cryo-EM techniques

  • Future research opportunities:

Research DirectionPotential ImpactTechnical Requirements
Ecological role of enzyme variantsUnderstanding niche adaptationComparative genomics, metatranscriptomics
Engineering heme metabolismImproved photosynthetic efficiencyPrecise genetic manipulation tools
Synthetic biology applicationsNovel biosynthetic pathwaysPredictive metabolic modeling
Climate change response mechanismsPredicting oceanic primary productionLong-term experimental evolution
Drug development targetsNovel antimicrobialsHigh-throughput screening platforms
  • Integrative approaches for future studies:

    • Combining laboratory studies with environmental sampling to validate ecological relevance

    • Developing synthetic microbial communities to study enzyme function in more complex settings

    • Implementing systems biology approaches to understand enzyme function in network context

    • Applying machine learning to predict enzyme properties from sequence and improve engineering efforts

    • Exploring potential biotechnological applications in renewable energy and carbon sequestration

  • Interdisciplinary collaboration opportunities:

    • Partner with structural biologists to determine high-resolution structures

    • Engage computational chemists for enzyme mechanism studies

    • Collaborate with oceanographers to understand environmental context

    • Work with synthetic biologists on novel applications of the enzyme

The field is moving toward more integrative approaches that combine multiple techniques and perspectives to understand not just the enzyme itself, but its role in cellular metabolism, ecological adaptation, and potential biotechnological applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.