Recombinant Procottus jettelesi Rhodopsin (rho)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing the order, and we will prepare accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize its development.
Synonyms
rho; Rhodopsin; Fragment
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-289
Protein Length
full length protein
Species
Procottus jeittelesii (Red sculpin)
Target Names
rho
Target Protein Sequence
YLVSPAAYAALGAYMFLLILVGFPVNFLTLYVTLDHKKLRTPLNYILLNLAVADLFMVLG GFTTTMYTSMHGYFVLGRLGCNLEGFFATLGGEIALWSLVVLAIERWIVVCKPISNFRFT EDHAIMGLAFSWVMALTCAVPPLVGWSRYIPEGMQCSCGVDYYTRAEGFNTESFVLYMFT VHFLIPLSVIFFCYGRLLCAVKEAAAAQQESETTQRAEKEVSRMVVLMVIGFLVCWLPYA SVAWWIFCNQGSEFGPIFMTLPAFFAKTSAIYNPLIYICMNKQFRHCMI
Uniprot No.

Target Background

Function
Rhodopsin is a photoreceptor essential for image-forming vision under low light conditions. While most saltwater fish species utilize retinal as the chromophore, most freshwater fish use 3-dehydroretinal or a mixture of retinal and 3-dehydroretinal. Light-induced isomerization of 11-cis to all-trans retinal triggers a conformational change that activates signaling through G-proteins. Subsequent receptor phosphorylation facilitates the displacement of the bound G-protein alpha subunit by arrestin, terminating the signaling process.
Protein Families
G-protein coupled receptor 1 family, Opsin subfamily
Subcellular Location
Membrane; Multi-pass membrane protein. Cell projection, cilium, photoreceptor outer segment.

Q&A

What is Procottus jettelesi Rhodopsin and what is its ecological significance?

Procottus jettelesi Rhodopsin (rho) is a visual pigment protein expressed in the retina of Procottus jettelesi (Red sculpin), a cottoid fish species endemic to Lake Baikal in Eastern Siberia. This rhodopsin belongs to the G protein-coupled receptor (GPCR) superfamily and functions as the primary photoreceptor protein for dim-light vision .

The ecological significance of P. jettelesi rhodopsin lies in its adaptation to the unique light environment of Lake Baikal, which is the deepest lake in the world (1600 m). P. jettelesi occupies sub-littoral to supra-abyssal habitats, and its rhodopsin properties reflect adaptations to these intermediate depth environments . Studies suggest that the spectral properties of rhodopsins from Lake Baikal cottoid fishes show a gradual blue-shift with increasing habitat depth, demonstrating a clear example of molecular adaptation to environmental conditions .

P. jettelesi is believed to be phylogenetically close to the ancestral form from which other Baikal cottoid species evolved, as its rhodopsin's spectral properties match those expected of the ancestral form .

What are the spectral properties of Procottus jettelesi Rhodopsin?

Procottus jettelesi rhodopsin exhibits specific absorption characteristics that are dependent on the chromophore bound to the protein. When expressed with the A1 chromophore (11-cis-retinal), P. jettelesi rhodopsin has an absorption maximum (λmax) of approximately 501 nm, as determined by in vitro expression and purification . This measurement shows a minor difference (-4 nm) from microspectroscopy (MSP) values reported in the literature .

When the same protein is expressed with the A2 chromophore (11-cis-3,4-dehydroretinal), the absorption maximum shifts to 520 nm, representing a significant red-shift of 19 nm compared to the A1 variant . This red-shift is consistent with the known effects of A2 chromophore substitution in visual pigments.

The following table summarizes the spectral properties of P. jettelesi rhodopsin compared to other Lake Baikal cottoid fish rhodopsins:

SpeciesHabitatλmax with A1 (nm)λmax with A2 (nm)Red-shift (nm)
P. jettelesiSub-littoral/Supra-abyssal50152019
C. inermisSupra-abyssal49551621
A. korotneffiAbyssal48249917

This spectral tuning across species demonstrates a clear adaptation pattern related to habitat depth .

What amino acid residues are responsible for spectral tuning in Procottus jettelesi Rhodopsin?

The spectral tuning of P. jettelesi rhodopsin, like other visual pigments, is primarily determined by specific amino acid residues that interact with the chromophore and affect the distribution of electron density in the conjugated π-system of retinal. Research using quantum mechanical/molecular mechanical (QM/MM) modeling and site-directed mutagenesis has identified several key residues that contribute to spectral tuning in Lake Baikal cottoid fish rhodopsins .

When comparing P. jettelesi to the more blue-shifted A. korotneffi rhodopsin, three key amino acid substitutions within the rhodopsin cavity have been identified: Y261F, A292S, and G114A . These substitutions modify the electrostatic environment around the chromophore through both direct and indirect mechanisms:

  • Y261F substitution: This replacement directly affects spectral tuning, causing a blue-shift through changes in the electrostatic interactions with the chromophore .

  • A292S substitution: This change indirectly affects spectral tuning by modifying the hydrogen bonding network (HBN) around the chromophore, resulting in a blue-shift .

  • G114A substitution: This substitution also contributes to spectral tuning through modifications of the protein environment around the chromophore .

Additionally, extra-cavity residues can also influence spectral tuning, though in P. jettelesi their contribution is more modest. For example, when comparing P. kneri (more red-shifted) to A. korotneffi (more blue-shifted), the red-shifting R140C replacement is counterbalanced by smaller blue-shifting replacements like T209I, L176S, and T297S .

The combination of these amino acid variations across species creates the gradient of spectral sensitivities observed in Lake Baikal cottoid fishes, reflecting their adaptations to different depth habitats .

How does thermal noise affect the function of Procottus jettelesi Rhodopsin and how is it modulated?

Thermal noise is a critical factor affecting the sensitivity of visual pigments in dim-light environments. In rhodopsins, thermal noise arises from spontaneous thermal isomerization of the chromophore, which can trigger the signaling cascade in the absence of light, creating "dark noise" that reduces visual sensitivity .

Research on P. jettelesi and other Lake Baikal cottoid fish rhodopsins has revealed a Barlow-type relationship between the absorption maximum (λmax) and the thermal isomerization rate, suggesting a mechanistic link between spectral tuning and thermal noise reduction . This relationship follows a key principle in visual adaptation: more blue-shifted pigments (typically found in deeper-water species) have lower rates of thermal isomerization, making them more suitable for detecting the blue-shifted light that penetrates to greater depths while minimizing noise interference .

Quantum mechanical/molecular mechanical (QM/MM) calculations have demonstrated that the activation energy for thermal isomerization (EaT) increases as the absorption maximum decreases (blue-shifts) . Specifically, comparisons between the most red-shifted P. kneri rhodopsin and the most blue-shifted A. korotneffi rhodopsin revealed a difference in activation energy of approximately 5.4 kcal mol^-1, with the blue-shifted pigment having the higher activation barrier .

The same amino acid substitutions responsible for spectral tuning (Y261F, A292S, and G114A) also modulate the thermal isomerization barrier . For example:

  • The Y261F substitution increases the activation energy in A. korotneffi compared to P. kneri, contributing to reduced thermal noise .

  • Similarly, the A292S substitution affects both spectral tuning and thermal noise by altering the protein's electrostatic environment .

This dual modulation of spectral sensitivity and thermal noise through the same amino acid substitutions represents an elegant example of molecular adaptation, enabling cottoid fish visual pigments to optimize for their specific depth environments in Lake Baikal .

What experimental methods are commonly used to study the properties of Procottus jettelesi Rhodopsin?

Several complementary experimental and computational approaches have been employed to characterize the properties of P. jettelesi rhodopsin:

1. In vitro Expression and Purification:
Recombinant expression systems are used to produce the protein for detailed biochemical and spectroscopic studies. This typically involves expressing the rhodopsin gene in mammalian cell lines, followed by reconstitution with either A1 or A2 chromophores to form functional visual pigments .

2. UV-Visible Spectroscopy:
This technique is fundamental for determining the absorption maximum (λmax) of the purified rhodopsin. Measurements are taken for both dark-adapted rhodopsin and after light exposure to characterize the spectral properties and light-induced conformational changes . The formation of photointermediates like Meta II can be monitored through spectral shifts.

3. Microspectrophotometry (MSP):
This method allows measurement of absorption spectra directly from isolated retinal tissue or single photoreceptor cells, providing in situ spectral characterization .

4. Site-Directed Mutagenesis:
This approach is used to investigate the role of specific amino acid residues in spectral tuning and function by creating variants with targeted amino acid substitutions .

5. Quantum Mechanical/Molecular Mechanical (QM/MM) Modeling:
This computational method combines quantum mechanical calculations for the chromophore with molecular mechanical simulations of the protein environment. QM/MM has been particularly valuable for analyzing the electronic effects of amino acid substitutions on spectral tuning and thermal activation barriers in P. jettelesi rhodopsin .

6. Homology Modeling:
When direct structural data is unavailable, homology models based on related rhodopsins with known structures (such as bovine rhodopsin) can provide structural insights .

7. Nakanishi Point-Charge Analysis:
This specialized computational approach has been used to analyze the electrostatic effects of conserved and non-conserved amino acid residues on the rhodopsin chromophore, helping to identify sites affecting spectral tuning and visual sensitivity .

These methods collectively provide a comprehensive understanding of the structural, spectral, and functional properties of P. jettelesi rhodopsin in comparison to other visual pigments.

What is the relationship between absorption maximum and activation energy in Procottus jettelesi Rhodopsin?

Research on P. jettelesi rhodopsin and other Lake Baikal cottoid fish rhodopsins has revealed a significant inverse relationship between the absorption maximum (λmax) and the activation energy for thermal isomerization (EaT) . This relationship is described as a linear correlation between EaT and 1/λmax, consistent with the Barlow hypothesis about visual pigment adaptation .

The QM/MM calculations demonstrated that as the absorption maximum blue-shifts (decreases in wavelength), the activation energy barrier for thermal isomerization increases . This relationship can be visualized in the following data:

Speciesλmax with A1 (nm)Relative EaT (kcal mol^-1)
P. kneri (littoral)~505 (most red-shifted)Baseline
P. jettelesi (sub-littoral)501+1.8 (estimated)
C. inermis (supra-abyssal)495+3.5 (estimated)
A. korotneffi (abyssal)482 (most blue-shifted)+5.4

The most blue-shifted rhodopsin (A. korotneffi) displays an activation energy approximately 5.4 kcal mol^-1 higher than the most red-shifted rhodopsin (P. kneri) .

This relationship has significant functional implications. Higher activation energy means lower probability of thermal isomerization at a given temperature, resulting in less thermal noise. This makes blue-shifted pigments better suited for detecting the blue-wavelength light that penetrates to greater depths in Lake Baikal, while simultaneously reducing false signals from thermal activation .

The underlying molecular mechanism involves the same amino acid substitutions that control spectral tuning. For example, the Y261F substitution both blue-shifts the absorption maximum and increases the activation energy barrier through modifications to the electrostatic environment around the chromophore .

This coupling between spectral tuning and noise reduction represents a sophisticated example of molecular adaptation that enables vision in the challenging deep-water environments of Lake Baikal .

How does the evolutionary adaptation of Procottus jettelesi Rhodopsin compare to other Lake Baikal cottoid species?

Procottus jettelesi occupies a significant position in the evolutionary adaptation of rhodopsins among Lake Baikal cottoid fishes. Based on spectral properties and phylogenetic analyses, P. jettelesi is proposed to be closest to the ancestral form from which other species evolved, as its λmax matches that expected of the ancestor .

The evolutionary relationships and adaptations can be characterized through comparison of rhodopsin properties across species inhabiting different depth zones:

  • Littoral Species (e.g., P. kneri): These shallow-water species possess the most red-shifted rhodopsins (λmax ~505 nm with A1 chromophore), adapted to the broader spectral range available in shallower waters .

  • Sub-littoral Species (P. jettelesi): With an intermediate λmax of 501 nm (A1 chromophore), P. jettelesi represents a transition between shallow and deep-water adaptations .

  • Supra-abyssal Species (e.g., C. inermis): These species have moderately blue-shifted rhodopsins (λmax ~495 nm with A1 chromophore) .

  • Abyssal Species (e.g., A. korotneffi): The deepest-dwelling species possess the most blue-shifted rhodopsins (λmax ~482 nm with A1 chromophore), optimized for detecting the blue-wavelength light that penetrates to greater depths while minimizing thermal noise .

The evolutionary adaptation across these species involves specific amino acid substitutions that simultaneously modify spectral sensitivity and thermal noise properties. The transitions between species can be characterized by the following key substitutions:

  • P. jettelesi to P. kneri (red-shift): Y261F substitution

  • P. jettelesi to C. inermis (slight blue-shift): Primarily extra-cavity substitutions (T297S, D83N)

  • P. jettelesi/C. inermis to A. korotneffi (significant blue-shift): A292S and G114A substitutions

These adaptive changes reflect a remarkable case of parallel evolution between spectral tuning and thermal noise reduction, enabling these fishes to exploit different depth niches in Lake Baikal through the optimization of their visual pigments . The correlation between habitat depth, absorption maximum, and thermal noise reduction demonstrates how molecular adaptation can facilitate ecological diversification in this unique aquatic ecosystem .

How can recombinant Procottus jettelesi Rhodopsin be expressed and purified for research purposes?

The expression and purification of recombinant P. jettelesi rhodopsin for research purposes typically follows established protocols for membrane proteins, with specific adaptations for visual pigments. Based on methodologies described in the literature for similar rhodopsins, the process generally includes these key steps:

1. Gene Cloning and Vector Construction:

  • The P. jettelesi rhodopsin gene (rho) is amplified from retinal cDNA or synthesized based on the known sequence (UniProt ID: O42451) .

  • The gene is cloned into an appropriate expression vector, often containing epitope tags (such as 1D4 tag) to facilitate purification .

2. Heterologous Expression:

  • Mammalian cell lines (typically HEK293 cells) are the preferred expression system for vertebrate rhodopsins as they provide appropriate post-translational modifications and membrane insertion .

  • Cells are transiently transfected with the expression construct and incubated in the dark to prevent premature activation of the expressed rhodopsin.

3. Chromophore Reconstitution:

  • For spectral analysis, the expressed opsin must be reconstituted with chromophore (either 11-cis-retinal for A1 rhodopsin or 11-cis-3,4-dehydroretinal for A2 rhodopsin) .

  • Chromophore addition is typically performed in the dark to form the functional rhodopsin.

4. Solubilization and Purification:

  • Cells are harvested and membranes containing the expressed rhodopsin are solubilized using mild detergents (commonly n-dodecyl-β-D-maltoside or CHAPS) .

  • The solubilized protein is purified using affinity chromatography, often using antibodies against the epitope tag.

  • For P. jettelesi rhodopsin, purification yields typically range from 10-50 μg of purified protein per preparation, depending on expression efficiency .

5. Quality Control:

  • The purified rhodopsin is characterized by UV-visible spectroscopy to confirm proper folding and chromophore binding, as indicated by the characteristic absorption peak around 501 nm (for A1 rhodopsin) .

  • Functional assessment includes light-induced bleaching experiments to verify the ability to undergo photoisomerization and formation of the Meta II photointermediate .

The resulting recombinant protein is typically stored in a Tris-based buffer with 50% glycerol at -20°C for short-term storage or -80°C for extended storage, with precautions to minimize freeze-thaw cycles .

What are the key considerations when designing experiments to compare Procottus jettelesi Rhodopsin with other visual pigments?

When designing comparative experiments with P. jettelesi rhodopsin and other visual pigments, researchers should consider several critical factors to ensure valid and meaningful results:

1. Chromophore Selection and Standardization:

  • Determine whether to use A1 (11-cis-retinal) or A2 (11-cis-3,4-dehydroretinal) chromophores, as this significantly affects spectral properties .

  • For direct comparisons between species, the same chromophore type must be used consistently across all samples.

  • Consider performing parallel experiments with both chromophore types to understand the full range of potential spectral tuning .

2. Expression System Consistency:

  • Use the same expression system for all compared rhodopsins to eliminate variables related to post-translational modifications or membrane composition.

  • Standardize expression conditions including temperature, duration, and cell density to minimize batch-to-batch variation .

3. Spectroscopic Measurement Controls:

  • Implement rigorous controls for factors that can affect spectral measurements, including pH, temperature, and buffer composition.

  • Use multiple measurement techniques when possible (e.g., both purified protein spectroscopy and microspectrophotometry of expressing cells) to validate findings .

  • Include well-characterized reference rhodopsins (such as bovine rhodopsin) as internal controls .

4. Mutagenesis Strategy:

  • When investigating the role of specific amino acid residues, design a systematic mutagenesis approach that includes:

    • Single amino acid substitutions to isolate individual effects

    • Combined substitutions to identify potential synergistic or antagonistic interactions

    • Reciprocal mutations between species (e.g., making P. jettelesi more like A. korotneffi and vice versa) to confirm the direction of spectral effects

5. Comprehensive Property Assessment:

  • Beyond measuring absorption maxima, consider evaluating:

    • Photobleaching kinetics and Meta II formation

    • Thermal stability and activation energy barriers

    • G protein activation efficiency

    • Meta II decay rates

  • These additional measurements provide a more complete picture of how spectral tuning relates to functional adaptation .

6. Structural Context Analysis:

  • Integrate spectroscopic data with structural modeling (e.g., homology models or QM/MM simulations) to understand the molecular mechanisms underlying observed differences .

  • Consider the whole protein environment rather than focusing exclusively on chromophore-adjacent residues .

7. Ecological and Evolutionary Context:

  • Interpret results in the context of the species' natural light environment and habitat depth .

  • Consider phylogenetic relationships when comparing across species to distinguish adaptive changes from neutral evolution .

Following these considerations ensures that comparative studies yield robust insights into the molecular basis of visual adaptation in Lake Baikal cottoid fishes and other systems.

What are common challenges in expressing functional Procottus jettelesi Rhodopsin and how can they be addressed?

Researchers working with P. jettelesi rhodopsin may encounter several challenges during the expression and characterization process. Based on experience with similar visual pigments, these challenges and their potential solutions include:

1. Low Expression Yields:

  • Challenge: Fish rhodopsins often express at lower levels than mammalian equivalents in heterologous systems.

  • Solutions:

    • Optimize codon usage for the expression system

    • Test multiple expression vectors with different promoters

    • Explore alternative cell lines (e.g., COS-1, HEK293T, SF9)

    • Include molecular chaperones as co-expression factors to improve folding

    • Consider using inducible expression systems to reduce potential toxicity

2. Protein Misfolding:

  • Challenge: Heterologously expressed rhodopsin may not fold properly, resulting in non-functional protein.

  • Solutions:

    • Express at lower temperatures (28-30°C instead of 37°C)

    • Add chemical chaperones to the culture medium (e.g., DMSO, glycerol)

    • Include the sodium butyrate to enhance proper protein folding

    • Consider creating chimeric constructs with mammalian rhodopsin segments known to improve folding

3. Insufficient Chromophore Incorporation:

  • Challenge: Poor loading efficiency of 11-cis-retinal or 11-cis-3,4-dehydroretinal.

  • Solutions:

    • Optimize chromophore:opsin ratio (typically 5:1 molar excess)

    • Extend incubation time with chromophore (12-24 hours) in the dark

    • Perform chromophore loading in detergent micelles rather than intact membranes

    • Use detergents that better preserve the native-like environment (e.g., CHAPS, digitonin)

4. Protein Instability:

  • Challenge: Rapid denaturation of purified rhodopsin during storage or experiments.

  • Solutions:

    • Include stabilizing agents in buffers (glycerol, specific lipids)

    • Store in small aliquots to minimize freeze-thaw cycles

    • Consider nanodiscs or reconstitution into lipid vesicles for enhanced stability

    • Maintain strict temperature control during purification (4°C)

5. A2 Chromophore Availability:

  • Challenge: 11-cis-3,4-dehydroretinal (A2 chromophore) is not commercially available.

  • Solutions:

    • Synthesize A2 chromophore following published protocols

    • Extract from appropriate natural sources (e.g., fish retinas)

    • Consider collaborations with specialized chemistry labs

6. Light Sensitivity During Handling:

  • Challenge: Premature photoactivation during expression and purification.

  • Solutions:

    • Perform all procedures under dim red light (>650 nm)

    • Use amber tubes and foil wrapping for additional protection

    • Include antioxidants in buffers to minimize damage from any accidental light exposure

7. Spectral Interference from Expression System:

  • Challenge: Background absorption or fluorescence from cell components.

  • Solutions:

    • Implement more stringent purification protocols

    • Use appropriate baseline corrections in spectroscopic measurements

    • Consider regeneration of purified opsin with chromophore after initial purification

By anticipating and addressing these challenges, researchers can improve the likelihood of successfully expressing and characterizing functional P. jettelesi rhodopsin for comparative and functional studies.

How can researchers distinguish between direct and indirect effects of amino acid substitutions on Procottus jettelesi Rhodopsin properties?

Distinguishing between direct and indirect effects of amino acid substitutions on rhodopsin properties is a complex challenge that requires a multi-faceted experimental and computational approach. For P. jettelesi rhodopsin research, several strategies have proven effective:

1. Combined Spectroscopic and Structural Analysis:

  • Methodology: Correlate spectroscopic measurements with structural data from homology models or QM/MM simulations to identify the mechanism of spectral shifts .

  • Application: Research on P. jettelesi and related cottoid rhodopsins has revealed that some substitutions (like Y261F) directly affect chromophore electrostatics, while others (like A292S) operate indirectly by altering hydrogen bonding networks .

2. Nakanishi Point-Charge Analysis:

3. Combinatorial Mutagenesis:

  • Methodology: Create a systematic series of mutants with individual and combined substitutions.

  • Application: If two substitutions have independent direct effects, their spectral shifts should be approximately additive when combined. Non-additive effects suggest indirect mechanisms or interactions between residues.

4. Analysis of Hydrogen Bonding Networks:

  • Methodology: Use molecular dynamics simulations to track changes in hydrogen bonding patterns resulting from amino acid substitutions.

  • Application: The A292S substitution in cottoid fish rhodopsins has been shown to exert its effects indirectly by reorganizing the hydrogen bonding network involving a water molecule (WAT2), ultimately affecting the chromophore environment .

5. Examination of Transition States:

  • Methodology: Compute the geometric structures of chromophores at transition states for thermal isomerization after various substitutions.

  • Application: Studies of P. jettelesi and related rhodopsins revealed significant differences in the transition state geometries between species, helping to explain how substitutions affect activation energy barriers .

6. Temperature-Dependent Kinetic Studies:

  • Methodology: Measure the thermal stability and activation rates of rhodopsin variants at multiple temperatures.

  • Application: Direct electronic effects often show different temperature dependence compared to effects mediated through protein conformational changes, helping to distinguish these mechanisms.

Through the integration of these approaches, researchers have determined that in P. jettelesi and related rhodopsins, amino acid substitutions can affect spectral tuning and thermal noise through three primary mechanisms :

  • Direct mechanism: Change in electrostatic interaction between the substituted residue and the chromophore (e.g., Y261F)

  • Indirect mechanism - type 1: Reorientation of conserved residues or water molecules (e.g., A292S affecting WAT2)

  • Indirect mechanism - type 2: Changes in protein tertiary structure affecting the chromophore binding pocket

These insights demonstrate how the combination of experimental and computational approaches can effectively distinguish between different mechanisms of amino acid substitution effects in rhodopsin research.

What are promising research areas for further understanding Procottus jettelesi Rhodopsin adaptations?

The study of P. jettelesi rhodopsin opens several promising avenues for future research that could enhance our understanding of visual adaptation mechanisms. Based on current knowledge gaps and technological advances, these areas include:

1. Comprehensive Structure-Function Analysis:

  • Approach: Obtain high-resolution structure of P. jettelesi rhodopsin through crystallography or cryo-EM techniques.

  • Potential insights: Detailed structural data would allow direct visualization of the chromophore binding pocket and validation of current computational models, potentially revealing additional adaptation mechanisms not captured by homology modeling .

2. In Vivo Visual Sensitivity Studies:

  • Approach: Develop methodologies to measure actual visual sensitivity in living P. jettelesi under controlled light conditions mimicking different depth environments.

  • Potential insights: Correlate molecular properties with organismal visual performance to establish the functional significance of the observed rhodopsin adaptations in ecological contexts .

3. Comparative Transcriptomics and Proteomics:

  • Approach: Analyze the complete visual transcriptome and proteome across Lake Baikal cottoid species from different depth habitats.

  • Potential insights: Identify coordinated adaptations in other components of the visual transduction cascade that may complement rhodopsin adaptations, providing a systems-level understanding of visual adaptation .

4. CRISPR-Based Rhodopsin Engineering:

  • Approach: Use CRISPR/Cas9 to create transgenic models with modified rhodopsin sequences to test evolutionary hypotheses.

  • Potential insights: Direct testing of the adaptive value of specific amino acid substitutions in controlled genetic backgrounds, potentially in model organisms like zebrafish.

5. Detailed Analysis of Photoactivation Kinetics:

  • Approach: Use ultra-fast spectroscopy to characterize the complete photocycle of P. jettelesi rhodopsin compared to related species.

  • Potential insights: Determine whether adaptations affecting spectral tuning and thermal noise also modify photoactivation efficiency or the kinetics of signaling states like Meta II formation .

6. Climate Change Impact Assessment:

  • Approach: Investigate how increasing water temperatures might affect the thermal noise properties of P. jettelesi rhodopsin compared to deep-water species.

  • Potential insights: Predict potential impacts of climate change on visual sensitivity across depth gradients, with implications for predator-prey interactions and species survival.

7. Ancestral Sequence Reconstruction:

  • Approach: Use phylogenetic methods to reconstruct the likely rhodopsin sequence of the ancestral Lake Baikal cottoid fish.

  • Potential insights: Test the hypothesis that P. jettelesi rhodopsin is indeed close to the ancestral form, and trace the evolutionary trajectory of spectral tuning in this radiation .

8. Expanded Comparative Analysis Across Teleost Fishes:

  • Approach: Compare the adaptations in Lake Baikal cottoids with similar adaptations in other freshwater and marine fish lineages that have independently colonized deep water habitats.

  • Potential insights: Identify convergent molecular solutions to similar ecological challenges, distinguishing between general principles and system-specific adaptations in visual pigment evolution.

These research directions would collectively provide a more comprehensive understanding of the molecular, cellular, and ecological aspects of visual adaptation in Lake Baikal cottoid fishes, with potential implications for understanding sensory adaptation more broadly.

How might findings from Procottus jettelesi Rhodopsin research inform the development of biomimetic light-sensing technologies?

Research on P. jettelesi rhodopsin and related visual pigments from Lake Baikal cottoid fishes offers several unique insights that could inspire innovative biomimetic light-sensing technologies:

1. Optimized Spectral Tuning for Low-Light Environments:

  • Application potential: The natural spectral tuning mechanisms observed in Lake Baikal rhodopsins could inform the development of highly sensitive photosensors optimized for specific wavelength ranges .

  • Technological approach: Engineer synthetic photoreceptive proteins or materials that incorporate the specific amino acid arrangements responsible for spectral tuning in P. jettelesi rhodopsin.

  • Potential applications: Enhanced low-light imaging systems, deep-sea exploration equipment, astronomical instruments, and medical imaging devices operating under limited illumination conditions.

2. Noise Reduction Strategies:

  • Application potential: The coupling between spectral tuning and thermal noise reduction observed in Lake Baikal rhodopsins represents a sophisticated mechanism for optimizing signal-to-noise ratio .

  • Technological approach: Apply similar principles to develop photosensors with reduced dark noise by modifying the energy barriers for spontaneous activation.

  • Potential applications: Ultra-sensitive detection systems requiring minimal false positives, such as in medical diagnostics, security scanners, and scientific instrumentation.

3. Chromophore-Protein Engineering:

  • Application potential: The distinct properties achieved through different chromophore combinations (A1 vs. A2) with the same opsin demonstrate a modular approach to tuning sensor properties .

  • Technological approach: Develop synthetic light-sensing systems with interchangeable chromophore components to allow customizable spectral sensitivity.

  • Potential applications: Tunable sensors for environmental monitoring, agricultural applications, and dynamic spectral imaging.

4. Environmental Adaptation Algorithms:

  • Application potential: The gradient of adaptations across different depth habitats demonstrates principles for optimizing sensors across varying environmental conditions .

  • Technological approach: Implement algorithmic approaches inspired by evolutionary adaptation to automatically optimize sensing parameters based on operating conditions.

  • Potential applications: Adaptive imaging systems that can automatically adjust sensitivity and spectral response based on ambient light conditions.

5. Energy-Efficient Photosensing:

  • Application potential: Natural rhodopsins achieve remarkable sensitivity with minimal energy requirements through optimized molecular structures .

  • Technological approach: Develop ultra-low-power photosensitive devices based on the energy efficiency principles of biological visual pigments.

  • Potential applications: Next-generation sensors for Internet of Things (IoT) devices, environmental monitoring stations, and wearable technology requiring minimal power consumption.

6. Protein-Based Optical Computing Components:

  • Application potential: The specific light-induced conformational changes in rhodopsins could inspire new approaches to optical computing and information processing .

  • Technological approach: Engineer rhodopsin-inspired proteins as components in biomolecular optical computing systems.

  • Potential applications: Biocompatible optical logic gates, memory components, and signal processing elements for next-generation computing architectures.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.