Recombinant Progestin and adipoq receptor-like protein 1 (paqr-1)

Shipped with Ice Packs
In Stock

Description

Expression Patterns and Tissue Distribution

PAQR-1 exhibits a distinct expression pattern in C. elegans tissues, indicating its specialized functions in different cellular contexts. The protein is consistently expressed in pharyngeal gland cells, excretory canal cell, vulva muscle, gonad sheath cell, intestine, and occasionally in body muscles . This expression profile differs from its paralog PAQR-2, which is found in head ganglion neurons, head muscle cells, pharyngeal M2 neurons, gonad sheath cell, seam cells, some ventral nerve cord and tail neurons, and occasionally in body muscles and intestine .

The differential expression patterns of PAQR family proteins suggest complementary yet distinct functions in various tissues. Notably, the intestine, which is the main fat-storing tissue in C. elegans, expresses PAQR-1, indicating its potential role in regulating lipid metabolism at the site of primary fat storage .

Biological Functions and Metabolic Regulation

PAQR-1 and its paralog PAQR-2 function as receptors that regulate fatty acid metabolism and facilitate adaptation to cold temperatures in C. elegans . Research has demonstrated that these proteins act redundantly but independently from PAQR-3, with their primary function being the promotion of energy utilization rather than storage .

Membrane Fluidity and Fatty Acid Regulation

A crucial function of PAQR-1 is the regulation of plasma membrane fluidity through the modulation of fatty acid composition. In conjunction with PAQR-2, it influences the expression of fatty acid desaturases and the incorporation of polyunsaturated fatty acids into phospholipids, thereby enhancing membrane fluidity . This function is particularly important for adaptation to environmental stressors such as cold temperatures or dietary changes that affect membrane composition.

Studies of mutant C. elegans strains have revealed that the double mutant paqr-1; paqr-2 exhibits highly elevated lipid content comparable to that of daf-2 mutants . Gas chromatography analysis of these mutants showed significant alterations in fatty acid profiles, with notably dramatic changes in 20-carbon polyunsaturated fatty acids, including arachidonic acid (C20:4n-6) and dihomo-γ linoleic acid (C20:3n-6) . These long-chain polyunsaturated fatty acids play critical roles in membrane composition and cellular signaling.

Cold Adaptation and Stress Response

PAQR-1 contributes to the organism's ability to adapt to cold temperatures, a process that typically involves modifying fatty acid composition to maintain appropriate membrane fluidity at lower temperatures . The proportion of specific fatty acids such as arachidonic acid has been shown to decrease when C. elegans are grown at low temperatures, suggesting active regulation of membrane composition in response to environmental temperature changes .

Genetic Interactions and Molecular Pathways

PAQR-1 participates in complex genetic interactions that reveal its integration into broader metabolic regulatory networks. Mutations in paqr-1 are synthetic lethal with mutations in sbp-1, the C. elegans homolog of SREBP (Sterol Regulatory Element-Binding Protein) . This genetic interaction highlights the critical role of PAQR-1 in pathways that involve lipid metabolism regulation.

Relationship with PAQR-2 and IGLR-2

Recent research utilizing a gain-of-function allele of PAQR-1 has provided insights into the functional relationship between PAQR-1 and other proteins. While PAQR-2 requires IGLR-2 (a homolog of mammalian LRIG proteins) to function properly, PAQR-1 does not require IGLR-2 but acts via the same pathway as PAQR-2 . The transmembrane domains of PAQR-2 are responsible for its functional requirement for IGLR-2, whereas the divergent N-terminal cytoplasmic domains of PAQR-1 and PAQR-2 serve regulatory functions and may control access to the catalytic sites of these proteins .

Suppressor Mutations and Metabolic Balance

Mutations in aak-2, the C. elegans homolog of AMP-activated protein kinase (AMPK), or nhr-80, a nuclear hormone receptor gene, can suppress the growth phenotype of paqr-2 mutants . This suppression likely occurs by restoring the balance between energy expenditure and storage, further emphasizing the role of PAQR-1 and PAQR-2 in energy homeostasis.

Recombinant Protein Applications and Research Tools

Recombinant PAQR-1 serves as a valuable research tool for investigating membrane biology, metabolic regulation, and the evolutionary conservation of adiponectin receptor-like proteins across species. The availability of purified recombinant protein enables various applications, including structural studies, interaction analyses, and functional assays.

Evolutionary Conservation and Homology

The PAQR family of proteins is highly conserved across metazoan evolution. In humans, the closest homologs to C. elegans PAQR-1 are ADIPOR1 and ADIPOR2, which function as receptors for adiponectin and regulate glucose and lipid metabolism . The conservation of these proteins suggests that they have played fundamental roles in metabolic regulation for at least 700 million years of evolutionary history .

Research has demonstrated that human ADIPOR1 and ADIPOR2 can confer increased resistance to palmitic acid when overexpressed in HEK293 cells, acting in a manner analogous to the PAQR-1 gain-of-function allele in C. elegans . This functional conservation across species highlights the fundamental importance of these receptor proteins in cellular metabolism and membrane homeostasis.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that we have in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will prepare the product accordingly.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributor for specific delivery time information.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to bring the contents to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers may use this as a reference.
Shelf Life
The shelf life is influenced by multiple factors, including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
paqr-1; CBG05420; Progestin and adipoQ receptor-like protein 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-423
Protein Length
full length protein
Species
Caenorhabditis briggsae
Target Names
paqr-1
Target Protein Sequence
MDPDEVNQALGHYLNDSESGELVVEDSTTVQVTNPEARKTGDKIEVYYSRKTTVVSPTNS DDEEGEFCSDSELLPAQGGHRSRATSFAGRVRAGSDDEMNPKHTVLRYRRKKGGQWREVN AQGTPDKRKDDEDELEVDVKEDRSEQTGIVTKTYEARWKVLKYEHLPEWLQDNEFLRHGH RPPLPSFAECFKSIWSLHTETGNIWTHLIGCVAFFLLACWFLTRPDNHIQFQEKVVFSFF FAGAVSVSDSRSPSTPSRVIRSTSSRYSANSTIWESRCSLSARLFQPKITYIAMVCVLGI GAIVVSLWDKFSESKYRPVRAAVFVGMGCSGVIPTIHYIITDGVHSLFADNSFHWLLLMA FLYLLGAALYATRTPERFFPGKCDIWFQSHQLFHTCVVIAAFVHYYGISEMAFARLNEQC PVR
Uniprot No.

Target Background

Function
This protein is a probable receptor that may play a role in metabolic pathways regulating lipid metabolism, particularly fatty acid oxidation.
Database Links

STRING: 6238.CBG05420

Protein Families
ADIPOR family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is PAQR-1 and what is its primary function in model organisms?

PAQR-1 is one of three C. elegans homologs of human adiponectin receptors (alongside PAQR-2 and PAQR-3). These proteins belong to the progesterone and adipoQ receptor (PAQR) family and function as key metabolic regulators in metazoans. In C. elegans, PAQR-1 and PAQR-2 act redundantly but independently from PAQR-3 to regulate fatty acid metabolism and energy utilization rather than storage . The primary function of these receptors appears to be protection against plasma membrane rigidification by promoting the expression of fatty acid desaturases and incorporation of polyunsaturated fatty acids into phospholipids, thereby increasing membrane fluidity . This metabolic regulatory role has been evolutionarily conserved for at least 700 million years across metazoan species .

Where is PAQR-1 expressed in C. elegans?

PAQR-1 shows a distinct tissue-specific expression pattern that provides insight into its physiological functions. Expression analysis using GFP reporter constructs reveals that PAQR-1 is consistently expressed in multiple tissues:

  • Pharyngeal gland cells

  • Excretory canal cell

  • Vulva muscle

  • Gonad sheath cells

  • Intestine (the main fat-storing tissue in C. elegans)

  • Occasionally in body muscles

This expression pattern differs significantly from that of PAQR-2 (expressed primarily in neurons, muscle cells, seam cells, and occasionally intestine) and PAQR-3 (expressed weakly in hypodermal cells) . The distinct expression patterns suggest tissue-specific roles for each PAQR homolog, with potential for both cell-autonomous and systemic effects given their expression in secretory tissues.

What is the structural organization of the PAQR-1 protein?

PAQR-1 is a multi-pass transmembrane protein with a structure that includes:

  • A cytoplasmic N-terminal domain

  • Seven transmembrane (TM) domains

  • A localization motif (LM)

The protein shows significant structural homology to human adiponectin receptors AdipoR1 and AdipoR2. Based on domain swapping experiments and sequence analysis, PAQR-1 shares varying degrees of sequence identity with PAQR-2 across different domains, with the transmembrane regions being more conserved than the cytoplasmic N-terminal domain .

The cytoplasmic N-terminal domain appears to serve a regulatory function, as evidenced by gain-of-function mutations (such as R109C) that enhance the protein's activity . The transmembrane domains, by contrast, likely constitute the catalytic region of the protein, involved in the core functional activities related to membrane fluidity regulation.

How does PAQR-1 relate to human adiponectin receptors?

PAQR-1 is a homolog of human adiponectin receptors AdipoR1 and AdipoR2, which are seven-transmembrane domain proteins that mediate the metabolic effects of adiponectin . The functional conservation between C. elegans PAQR proteins and human adiponectin receptors extends to their biological activities:

  • Both protect against plasma membrane rigidification

  • Both promote fatty acid desaturation

  • Both are involved in metabolism regulation, particularly in response to dietary challenges

This conservation is further evidenced by functional studies showing that overexpression of human AdipoR1 or AdipoR2 alone is sufficient to confer increased palmitic acid resistance in HEK293 cells, acting analogously to the PAQR-1 gain-of-function allele in C. elegans . This suggests that the core mechanism of action has been preserved through evolution, making C. elegans PAQR proteins valuable models for studying adiponectin receptor biology and its implications for human metabolic disorders.

What genetic tools are available for studying PAQR-1 function?

Researchers have developed several genetic tools to investigate PAQR-1 function:

  • Mutant Alleles:

    • Loss-of-function mutants for phenotypic analysis

    • Gain-of-function allele paqr-1(et52) encoding an R109C substitution in the N-terminal cytoplasmic domain

    • CRISPR/Cas9-modified alleles for protein tagging (e.g., paqr-1(syb1401) encoding HA::PAQR-1)

  • Transgenic Reporter Lines:

    • Ppaqr-1::PAQR-1WT::GFP for wild-type protein expression and localization studies

    • Ppaqr-1::PAQR-1R109C::GFP for studying the gain-of-function variant

  • Domain-Swapped Constructs:

    • Chimeric proteins combining domains from PAQR-1 and PAQR-2 for structure-function analysis

  • Double and Triple Mutants:

    • paqr-1; paqr-2 double mutants to assess functional redundancy

    • Synthetic lethal combinations with other metabolic regulators (e.g., paqr-1; sbp-1)

These tools enable comprehensive functional characterization of PAQR-1 through genetic, cell biological, and biochemical approaches in an intact organism.

How does the gain-of-function allele paqr-1(et52) affect protein function and phenotypes?

The paqr-1(et52) allele encodes an R109C substitution in the cytoplasmic N-terminal domain of PAQR-1 and functions as a gain-of-function mutation with significant physiological effects .

Molecular Effects:

  • The R109C substitution likely alters the regulatory function of the N-terminal domain

  • Western blot analysis of HA-tagged proteins shows that the mutation does not significantly alter protein expression levels

  • Confocal imaging of GFP-tagged PAQR-1(R109C) reveals plasma membrane localization similar to wild-type PAQR-1, but with differences in tissue expression frequencies

Phenotypic Effects:

  • PAQR-1(R109C) suppresses the glucose intolerance phenotype of paqr-2 mutants, while wild-type PAQR-1 does not

  • The substitution enables PAQR-1 to function independently of IGLR-2, a protein normally required by PAQR-2 for activity

  • Similar phenotypic suppression is observed with an engineered R109A substitution, suggesting that removal of the positive charge at position 109 is the critical factor

These findings indicate that the N-terminal cytoplasmic domain serves a regulatory function, potentially controlling access to the catalytic site of PAQR-1. The R109C substitution appears to release the protein from normal regulatory constraints, enhancing its activity and allowing it to compensate for the loss of PAQR-2.

What is the relationship between PAQR-1 and PAQR-2 in terms of functional redundancy?

PAQR-1 and PAQR-2 exhibit a complex relationship characterized by partial functional redundancy but with distinct physiological roles:

Functional Redundancy:

  • Both proteins act in the same metabolic pathway to regulate fatty acid composition and membrane fluidity

  • Double mutants (paqr-1; paqr-2) show more severe phenotypes than either single mutant, particularly in fatty acid composition

Distinct Functions:

  • PAQR-2 is the more important of the two proteins; paqr-2 mutants have more severe phenotypes including poor growth and failure to adapt to low temperature

  • PAQR-1 does not normally require IGLR-2 for function, while PAQR-2 does

  • Their expression patterns differ significantly across tissues, suggesting tissue-specific roles

Molecular Basis for Functional Differences:

  • Domain swapping experiments indicate that the transmembrane domains of PAQR-2 are responsible for its functional requirement for IGLR-2

  • The divergent N-terminal cytoplasmic domains serve regulatory functions and may determine the distinct activities of each protein

This relationship demonstrates how evolutionarily related proteins can develop specialized functions while maintaining core biochemical activities, providing redundancy for essential metabolic processes while allowing for tissue-specific or condition-specific responses.

How do paqr-1 mutations affect fatty acid metabolism in C. elegans?

PAQR-1, particularly in conjunction with PAQR-2, plays a critical role in regulating fatty acid composition and metabolism in C. elegans:

Effects on Total Fat Content:

  • The paqr-1; paqr-2 double mutant exhibits a very high fat content compared to wild-type worms

Alterations in Fatty Acid Composition:

  • The most significant changes in paqr-1; paqr-2 double mutants concern 20-carbon polyunsaturated fatty acids

  • 4 out of 5 monitored 20-carbon polyunsaturated fatty acids were highly elevated in the double mutants

  • Some affected lipids, such as arachidonic acid (C20:4n-6), play important roles as components of cellular membranes or in cellular signaling

Relationship to Membrane Fluidity Regulation:

  • PAQR-1 and PAQR-2 protect against plasma membrane rigidification by promoting:

    • Expression of fatty acid desaturases

    • Incorporation of polyunsaturated fatty acids into phospholipids

Temperature Adaptation:

  • The proportion of arachidonic acid and dihomo-γ linoleic acid (C20:3n-6) has been shown to decrease when C. elegans are grown at low temperatures

  • PAQR-1 and PAQR-2 are involved in cold adaptation, likely through their regulation of membrane lipid composition

These findings indicate that PAQR-1 and PAQR-2 are central regulators of lipid homeostasis in C. elegans, coordinating fatty acid desaturation and incorporation into membrane phospholipids to maintain appropriate membrane fluidity under varying environmental conditions.

What experimental approaches are most effective for structure-function analysis of PAQR-1?

Several complementary experimental approaches have proven effective for dissecting the structure-function relationships of PAQR-1:

CRISPR/Cas9 Genome Editing:

  • Generation of endogenous tagged proteins (e.g., HA::PAQR-1) for expression analysis

  • Introduction of specific amino acid substitutions to test their functional consequences

  • Creation of domain deletion variants to assess the contributions of specific protein regions

Domain Swapping Experiments:

  • Construction of chimeric proteins combining domains from PAQR-1 and PAQR-2

  • Expression of these constructs in mutant backgrounds to determine which domains confer specific functions

  • This approach has revealed that the transmembrane domains of PAQR-2 require IGLR-2 for activity, while the N-terminal domains likely serve regulatory functions

Transgenic Expression Systems:

  • Expression of wild-type and mutant proteins fused to fluorescent reporters (e.g., GFP)

  • Analysis of subcellular localization and tissue expression patterns

  • Rescue experiments to test the ability of modified proteins to complement mutant phenotypes

Phenotypic Assays for Functional Assessment:

  • Growth measurements under normal and challenged conditions (e.g., glucose supplementation, low temperature)

  • Fatty acid composition analysis by gas chromatography-mass spectrometry

  • Synthetic lethality tests with mutations in related metabolic pathways

These approaches have collectively demonstrated that:

  • The N-terminal cytoplasmic domains serve regulatory functions

  • The transmembrane domains likely constitute the catalytic core

  • Specific amino acid substitutions (e.g., R109C) can dramatically alter protein function without changing localization

How does PAQR-1 interact with other metabolic regulatory pathways in C. elegans?

PAQR-1 functions within a complex network of metabolic regulatory pathways, as evidenced by genetic interactions with several key metabolic regulators:

Synthetic Lethal Interactions:
PAQR-1 exhibits synthetic lethality with mutations in:

  • sbp-1: C. elegans homolog of SREBP (sterol regulatory element-binding protein), a master regulator of lipid metabolism

  • This synthetic lethality suggests that PAQR-1 and SBP-1 operate in parallel but complementary pathways essential for lipid homeostasis

Interaction with Nuclear Hormone Receptors:

  • PAQR-2 is synthetic lethal with nhr-49, a C. elegans homolog of nuclear hormone receptors involved in fat metabolism

  • While PAQR-1 alone doesn't show this interaction, the double paqr-1; paqr-2 mutant likely enhances this effect

Suppressor Interactions:

  • Mutations in aak-2 (the C. elegans homolog of AMPK, AMP-activated protein kinase) suppress the growth phenotype of paqr-2 mutants

  • Similarly, mutations in nhr-80 (another nuclear hormone receptor) suppress paqr-2 phenotypes

  • These suppressors likely restore the balance between energy expenditure and storage

Relationship with Δ9 Desaturases:

  • PAQR-2 is synthetic lethal with fat-6, which encodes a Δ9 desaturase

  • This interaction highlights the importance of fatty acid desaturation in the PAQR-1/2 pathway

These genetic interactions place PAQR-1 within a broader network of metabolic regulators that collectively coordinate lipid homeostasis, energy balance, and membrane composition in response to environmental and nutritional challenges.

What can we learn from comparing PAQR-1 function across species?

Comparative analysis of PAQR-1 and related proteins across species provides valuable insights into evolutionary conservation and functional adaptation:

Functional Conservation from C. elegans to Humans:

  • PAQR-1 is one of three C. elegans homologs of human adiponectin receptors, with PAQR proteins having regulated metabolism in metazoans for at least 700 million years

  • Overexpression of human AdipoR1 or AdipoR2 confers increased palmitic acid resistance in HEK293 cells, analogous to the effect of the PAQR-1 gain-of-function allele in C. elegans

  • This functional conservation suggests that the core mechanism of action has been preserved through evolution

Structural Insights from Cross-Species Comparison:

  • The seven-transmembrane domain structure is conserved from C. elegans to humans

  • The N-terminal cytoplasmic domains show greater sequence divergence than the transmembrane regions, suggesting evolutionary adaptation of regulatory mechanisms while preserving core catalytic functions

Physiological Roles Across Species:

  • In humans, adiponectin receptors regulate glucose metabolism and fatty acid oxidation

  • In C. elegans, PAQR proteins regulate fatty acid desaturation and cold adaptation

  • These differences likely reflect adaptations to the distinct physiological needs and environmental challenges of each species

Translational Implications:

  • The functional homology between C. elegans PAQR-1 and human adiponectin receptors makes C. elegans a valuable model for studying adiponectin receptor biology

  • Structure-function studies in C. elegans can inform the development of targeted therapeutics for metabolic disorders in humans

  • The gain-of-function mechanism identified in PAQR-1(R109C) might suggest strategies for enhancing adiponectin receptor activity in metabolic disease contexts

How can researchers effectively measure membrane fluidity changes associated with PAQR-1 function?

Given that PAQR-1 and PAQR-2 protect against plasma membrane rigidification, assessing membrane fluidity is critical for understanding their function. Several methodological approaches can be employed:

Fatty Acid Composition Analysis:

  • Gas chromatography-mass spectrometry (GC-MS) to quantify changes in fatty acid profiles, particularly polyunsaturated fatty acids

  • Special attention to 20-carbon polyunsaturated fatty acids (e.g., arachidonic acid, dihomo-γ linoleic acid) that show significant changes in paqr mutants

  • Analysis of phospholipid species to determine how fatty acid changes affect membrane composition

Direct Membrane Fluidity Measurements:

  • Fluorescence recovery after photobleaching (FRAP) to measure lateral diffusion of membrane components

  • Anisotropy measurements using polarized fluorescence to assess membrane rigidity

  • Atomic force microscopy to evaluate membrane mechanical properties

Temperature-Based Assays:

  • Growth assessments at different temperatures, particularly low temperatures where membrane rigidity increases

  • Cold adaptation tests to evaluate how PAQR-1 function affects temperature responses

  • Membrane phase transition temperature measurements using differential scanning calorimetry

Genetic Reporter Systems:

  • Monitoring expression of fatty acid desaturases in response to membrane fluidity changes

  • Using stress-responsive promoters linked to fluorescent reporters to assess cellular responses to membrane rigidity

Functional Assays in Response to Membrane-Rigidifying Agents:

  • Growth assays in the presence of saturated fatty acids (e.g., palmitic acid) or glucose, which can induce membrane rigidification

  • Measurement of developmental progression and body size as indicators of successful adaptation to membrane stress

These methodologies, used in combination, provide comprehensive insights into how PAQR-1 influences membrane properties and how these changes affect cellular and organismal physiology under various environmental conditions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.