Recombinant Prolipoprotein diacylglyceryl transferase (lgt)

Shipped with Ice Packs
In Stock

Description

Biochemical Role and Mechanism

Lgt performs the first of three essential reactions in bacterial lipoprotein maturation:

  • Substrate recognition: Targets the lipobox motif ([LVI][ASTVI][GAS]C) in prolipoproteins

  • Catalytic activity: Transfers the sn-1,2-diacylglyceryl group from PG to the thiol group of cysteine via thioether bond formation

  • By-product release: Generates glycerol phosphate (G1P/G3P) during the reaction

Key functional assays:

Assay TypeMethodologyKey FindingsSource
GFP-based in vitroFluorescent lipoGFP substrateConfirmed enzymatic activity of Lgt
Radiolabeling14C-palmitic acid incorporationDemonstrated Lgt's exclusive role in lipidation
Coupled luciferaseDetection of G3P releaseQuantified substrate specificity

Genetic and Functional Studies

  • Essentiality: lgt deletion is lethal in E. coli and Acinetobacter baumannii

  • Phenotypic effects of inhibition:

    • Outer membrane destabilization

    • Increased antibiotic susceptibility (e.g., 64-fold MIC reduction for colistin)

    • Loss of peptidoglycan-Lpp tethering

Essential residues identified through mutagenesis:

ResidueFunctionComplementation Outcome
R143ADisrupted PG bindingNon-functional
R239AImpaired catalytic activityNon-functional
Y26AStructural destabilizationLethal

Inhibitor Development and Resistance Profile

First-generation Lgt inhibitors (Lgti) exhibit:

  • Biochemical potency: IC50 values <1 μM in in vitro assays

  • Bactericidal activity: MIC90 values of 2-4 μg/mL against multidrug-resistant A. baumannii

  • Resistance avoidance: Unlike LspA inhibitors (e.g., globomycin), Lgti remain effective in Δlpp strains

Research Implications

  1. Therapeutic potential: Lgt represents a novel antibacterial target with reduced susceptibility to common resistance mechanisms

  2. Structural insights: The PG-bound crystal structure enables rational drug design targeting the substrate-binding pocket

  3. Biotechnological applications: Recombinant Lgt serves as a tool for studying lipoprotein trafficking and membrane biogenesis

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
lgt; SAV_6180; Phosphatidylglycerol--prolipoprotein diacylglyceryl transferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-340
Protein Length
full length protein
Species
Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)
Target Names
lgt
Target Protein Sequence
MELAYIPSPARGVLYLGPIPLRGYAFCIIIGVFVAVWLGNKRWVARGGRPGTVADIAVWA VPFGLVGGRLYHVITDYELYFSEGRDWVDAFKIWEGGLGIWGAIALGAVGAWIGCRRRGI PLPAWADAVAPGIAFAQAFGRWGNWFNQELYGRETHVPWALHITSSTDGRVPGYYHPTFL YESLWCVGVGFLVIWADRRFKLGHGRAFALYVAAYCVGRAWIEYMRVDDAHHILGVRLND WTAIAVFLLAVLYIVLSSRKRPGREEIVEPGASDTGTGADDPVDLGKDEDKATTDKATAT DTSTTTDKSTDRGKNEDENEGEDAEPSEKTESAAESAKKV
Uniprot No.

Target Background

Function

Recombinant Prolipoprotein diacylglyceryl transferase (Lgt) catalyzes the transfer of the diacylglyceryl group from phosphatidylglycerol to the sulfhydryl group of the N-terminal cysteine of a prolipoprotein. This is the initial step in the maturation of lipoproteins.

Database Links
Protein Families
Lgt family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the basic function of prolipoprotein diacylglyceryl transferase (Lgt) in bacterial systems?

Lgt catalyzes the first and critical step in the three-step post-translational lipid modification pathway of bacterial lipoproteins. Specifically, it transfers a diacylglyceryl moiety from phosphatidylglycerol to the conserved cysteine residue in the lipobox of prolipoproteins via formation of a thioether bond. This reaction results in the release of glycerol phosphate as a byproduct and represents the initial step in a pathway essential for bacterial envelope integrity and various cellular functions . The modification is crucial for proper anchoring of lipoproteins to bacterial membranes, which subsequently enables these proteins to perform diverse functions including cell envelope maintenance, nutrient uptake, transport, and virulence in pathogenic species . The essentiality of this enzyme is underscored by the fact that deletion of the lgt gene is lethal to most Gram-negative bacteria .

How is the membrane topology of Lgt organized, and what implications does this have for its function?

Extensive experimental analysis using alkaline phosphatase and beta-lactamase fusions, combined with substituted cysteine accessibility methods (SCAM), has definitively established that Lgt from Escherichia coli contains seven transmembrane domains . This topology explains the challenges researchers have faced in structural characterization of Lgt since its discovery. The membrane organization positions critical conserved residues optimally for catalytic activity, with the prolipoprotein diacylglyceryl transferase signature (residues 142-154) split between the periplasmic space and inner membrane . This arrangement facilitates lateral substrate entry and product exit relative to the lipid bilayer, allowing Lgt to access both membrane-embedded phosphatidylglycerol and emerging prolipoproteins . The transmembrane organization also clarifies why previous bioinformatic analyses yielded conflicting predictions of five versus seven transmembrane domains, highlighting the limitations of computational approaches in accurately predicting complex membrane protein structures .

What are the most effective methods for expressing and purifying recombinant Lgt for structural studies?

For successful structural studies of membrane-embedded enzymes like Lgt, researchers must overcome significant challenges in expression and purification. The crystal structures of E. coli Lgt were determined at impressive resolutions of 1.9 Å (with phosphatidylglycerol) and 1.6 Å (with inhibitor palmitic acid) . This achievement required optimized protocols addressing the hydrophobic nature of Lgt.

The recommended methodology involves:

  • Expression system selection: E. coli BL21(DE3) with tightly controlled induction systems to prevent toxicity.

  • Membrane fraction isolation: Careful cell disruption followed by differential centrifugation to isolate membrane fractions.

  • Detergent solubilization: Screening multiple detergents (typically DDM, LDAO, or C12E8) for optimal protein stability and activity.

  • Purification strategy: Multi-step chromatography including:

    • Nickel affinity chromatography (for His-tagged constructs)

    • Size exclusion chromatography to remove aggregates

    • Ion exchange chromatography for final polishing

Critical considerations include maintaining a controlled temperature (typically 18-20°C) during expression to prevent inclusion body formation and inclusion of phospholipids during purification to maintain enzyme stability . Verification of functional activity in the purified protein using enzymatic assays is essential before proceeding to crystallization trials.

How can researchers effectively design and implement activity assays for Lgt?

A robust activity assay for Lgt involves measuring the release of glycerol phosphate, which is a byproduct of the Lgt-catalyzed transfer of diacylglyceryl from phosphatidylglycerol to a peptide substrate. The peptide substrate typically used is derived from the Pal lipoprotein (Pal-IAAC), where the terminal cysteine represents the conserved residue that undergoes modification .

The recommended methodology involves:

  • Substrate preparation:

    • Synthetic peptide containing the lipobox motif (L-A/S-G/A-C)

    • Purified phosphatidylglycerol (typically with racemic glycerol moiety)

  • Reaction conditions:

    • Buffer: Typically 50 mM HEPES pH 7.5, 150 mM NaCl

    • Detergent: 0.1% DDM or equivalent to maintain enzyme activity

    • Temperature: 30-37°C optimal for most bacterial Lgt enzymes

  • Detection methods:

    • Coupled luciferase-based assay to detect released G3P

    • Alternative: HPLC-based quantification of modified peptide

    • Mass spectrometry to confirm addition of diacylglyceryl moiety

Since commercial phosphatidylglycerol typically contains a racemic glycerol moiety, both glycerol-1-phosphate (G1P) and glycerol-3-phosphate (G3P) may be released as Lgt catalyzes the reaction . Therefore, assay designs should account for detection of both forms or standardize based on total phosphate release.

What approaches are most effective for generating and characterizing Lgt-deficient bacterial strains?

The most effective methodology involves:

  • For non-essential Lgt systems (some Gram-positives):

    • Homologous recombination using temperature-sensitive shuttle vectors (e.g., pSET5)

    • Replacement of the lgt gene with an antibiotic resistance cassette (e.g., spectinomycin)

    • Selection of transformants at permissive temperature followed by shift to non-permissive temperature to force chromosomal integration

    • Confirmation of mutation by PCR using primers flanking the integration site and Southern blotting

  • For essential Lgt systems (Gram-negatives):

    • Construction of conditional knockout strains using inducible promoters

    • Depletion experiments by removing the inducer

    • Monitoring growth characteristics and lipoprotein processing

    • Western blot analysis to detect accumulation of unprocessed forms of lipoproteins (UPLP)

  • Complementation studies:

    • Re-introduction of intact lgt gene on expression plasmids

    • Inclusion of native promoter for physiological expression levels

    • Addition of marker genes (e.g., chloramphenicol resistance) for selection

    • Verification of expression by qRT-PCR

When characterizing the resulting strains, researchers should examine growth kinetics (typically showing increased lag phase), morphological changes, lipoprotein processing status, and altered immune recognition patterns .

What are the critical residues for Lgt activity, and how should mutation studies be designed to evaluate their roles?

Mutational analyses have identified several conserved residues essential for Lgt activity. Comprehensive bioinformatic analysis across diverse bacterial phyla including Firmicutes, Proteobacteria, and Actinobacteria has revealed five universally conserved residues in Lgt .

The critical residues include:

  • R143 and G154 (located within the prolipoprotein diacylglyceryl transferase signature)

  • Y26 (conserved across all bacterial Lgt enzymes)

  • R239 (essential for diacylglyceryl transfer)

  • H103 and Y235 (implicated as critical for catalytic activity)

For effective mutation studies:

  • Selection of residues:

    • Target universally conserved amino acids

    • Include residues in the prolipoprotein diacylglyceryl transferase signature (PS01311)

    • Consider residues in transmembrane regions and substrate binding sites

  • Mutation strategy:

    • Conservative mutations (e.g., Y26F) to retain structural features

    • Non-conservative mutations (e.g., Y26A) to completely disrupt function

    • Mutations that alter charge (R143E) or polarity (H103A)

  • Functional validation:

    • Complementation assays in conditional lgt knockout strains

    • In vitro enzyme activity assays with purified mutant proteins

    • Structural analysis to determine effects on substrate binding

  • Expression verification:

    • Critical to confirm that loss of function is not due to reduced expression

    • Western blotting to quantify protein levels

    • Membrane localization studies to confirm proper insertion

A key consideration highlighted by previous research is that there isn't always a direct correlation between protein expression levels and functionality; therefore, both factors must be independently evaluated .

What do the crystal structures of Lgt reveal about its catalytic mechanism?

The crystal structures of E. coli Lgt in complex with phosphatidylglycerol (1.9 Å) and the inhibitor palmitic acid (1.6 Å) have provided unprecedented insights into the catalytic mechanism . These structures reveal:

  • Dual binding sites: Lgt possesses two distinct binding sites - one for phosphatidylglycerol and another for the lipobox-containing peptide.

  • Catalytic pocket: The active site is formed within the transmembrane regions with key residues positioned to:

    • Bind the phosphate head group of phosphatidylglycerol

    • Coordinate the conserved cysteine of the lipobox

    • Facilitate nucleophilic attack on the diacylglyceryl moiety

  • Lateral access model: The structures support a mechanism whereby substrate enters and modified product leaves the enzyme laterally relative to the lipid bilayer. This lateral gate mechanism enables Lgt to access membrane-embedded phosphatidylglycerol and process emerging prelipoproteins without disrupting membrane integrity .

  • Essential arginine residues: Arg143 and Arg239 play critical roles in coordinating the phosphate group of phosphatidylglycerol and facilitating diacylglyceryl transfer. Mutation of these residues abolishes enzymatic activity while maintaining proper protein folding and membrane insertion .

The structural data, combined with complementation studies and in vitro assays, support a mechanism involving direct transfer of the diacylglyceryl moiety from phosphatidylglycerol to the conserved cysteine via a thioether bond formation, rather than the previously proposed multi-step process involving separate glycerylation and acylation steps .

How does Lgt select its lipoprotein substrates, and what specific features of the lipobox are critical for recognition?

Lgt substrate recognition centers on the lipobox motif, typically represented as L-A/S-G/A-C, with the terminal cysteine being essential for modification. Several features influence substrate selection:

  • Signal peptide requirements:

    • The presence of a hydrophobic N-terminal signal sequence preceding the lipobox

    • Proper processing by signal peptidase to expose the lipobox for Lgt access

    • Potential differences in hydrophobic and hydrophilic signal peptides suggesting different Lgt specificities

  • Lipobox consensus sequence:

    • Absolutely conserved cysteine at position +1 (modification site)

    • Strong preference for leucine at position -3

    • Alanine or serine preference at position -2

    • Glycine or alanine preference at position -1

  • Structural positioning:

    • The lipobox must be properly positioned at the interface between the signal peptide and mature protein

    • Accessibility to Lgt within the membrane environment is critical

The existence of Lgt paralogues in some Gram-positive bacteria suggests potential substrate-specific processing similar to substrate-specific sortase enzymes . Some evidence points to differential processing based on signal peptide characteristics, with distinct Lgt enzymes potentially specialized for lipoproteins with either hydrophobic or hydrophilic signal peptides .

How does Lgt structure and function vary across different bacterial species, and what implications does this have for targeted research?

Lgt shows remarkable conservation of core functional domains across diverse bacterial phyla while exhibiting species-specific adaptations. Key comparative insights include:

  • Conservation pattern:

    • Core catalytic residues (R143, G154, Y26, R239, H103, Y235) are universally conserved

    • Prolipoprotein diacylglyceryl transferase signature (PS01311) is maintained across species

    • Seven transmembrane domain architecture appears consistent in characterized enzymes

  • Species variations:

    • Sequence identity: S. suis Lgt shows 67% amino acid sequence identity to S. pneumoniae Lgt

    • Essentiality: Lgt is essential in most Gram-negative bacteria but dispensable in some Gram-positives

    • Paralogues: Multiple lgt genes exist in several Gram-positive species, suggesting specialized functions

  • Functional differences:

    • Growth phenotypes: Δlgt mutants in S. suis remain viable with minor growth defects (increased lag phase)

    • Virulence impacts: Lgt is required for full virulence in Bacillus anthracis

    • Immune recognition: Differential processing affects TLR2 recognition patterns

This comparative understanding has significant research implications:

  • Target selection: For antimicrobial development, focus on Gram-negative Lgt where the enzyme is essential

  • Model organisms: Choose appropriate bacterial models based on conservation relative to target species

  • Functional prediction: Leverage comparative genomics to predict substrate specificity and function of uncharacterized Lgt enzymes

What role does Lgt play in bacterial pathogenesis and immune system recognition?

Lgt plays a multifaceted role in bacterial pathogenesis and immune recognition:

  • Virulence contribution:

    • Processing of essential virulence-associated lipoproteins

    • Maintenance of membrane integrity critical for survival in host environments

    • Contribution to antibiotic resistance mechanisms

    • Requirement for full virulence demonstrated in B. anthracis and likely other pathogens

  • Immune recognition pathways:

    • Bacterial lipoproteins are recognized by Toll-like receptors (TLRs) of the innate immune system

    • TLR2 is key for lipoprotein recognition, heterodimerizing with either TLR6 (for diacylated lipoproteins) or TLR1 (for triacylated lipoproteins)

    • Proper Lgt processing is required for full TLR2 activation

    • Lipoproteins from S. suis are major activators of the innate immune system in pigs

  • Immunomodulation strategies:

    • Some pathogens may regulate Lgt activity to evade immune detection

    • Δlgt mutants typically show altered immune stimulation profiles

    • The acyl chains processed by Lgt are directly recognized as pathogen-associated molecular patterns (PAMPs)

Understanding these interactions is critical for vaccine development and therapeutic approaches. Lipoproteins represent excellent vaccine candidates due to their surface exposure and immunogenicity, while Lgt represents a potential antimicrobial target in Gram-negative pathogens where it is essential .

How can inhibitors of Lgt be designed and evaluated for potential antimicrobial applications?

Developing Lgt inhibitors represents a promising antimicrobial strategy, particularly for Gram-negative pathogens where the enzyme is essential. A systematic approach includes:

  • Rational inhibitor design:

    • Structure-based approaches leveraging the high-resolution crystal structures of E. coli Lgt

    • Focus on compounds that mimic phosphatidylglycerol (substrate competitive)

    • Target the lateral gate mechanism to prevent substrate access

    • Design transition state analogues that mimic the reaction intermediate

  • Screening methodologies:

    • High-throughput biochemical assays measuring inhibition of glycerol phosphate release

    • Cell-based assays monitoring accumulation of unprocessed lipoproteins (UPLP)

    • Competitive binding assays using fluorescently-labeled phosphatidylglycerol

  • Validation approaches:

    • Crystallographic confirmation of inhibitor binding mode

    • Bacterial growth inhibition studies using conditional lgt strains

    • Assessment of species-specificity across diverse bacterial pathogens

    • Synergy testing with existing antibiotics

  • Medicinal chemistry optimization:

    • Improve membrane permeability for access to the bacterial inner membrane

    • Enhance selectivity for bacterial over mammalian enzymes

    • Optimize pharmacokinetic properties for in vivo efficacy

Palmitic acid has been identified as an inhibitor of Lgt and was co-crystallized with the enzyme at 1.6 Å resolution , providing a starting point for future inhibitor development efforts.

What techniques are most effective for studying the Lgt-dependent lipoproteome in different bacterial species?

Comprehensive analysis of the Lgt-dependent lipoproteome requires integrated approaches:

  • Comparative proteomics:

    • Label-free quantitative proteomics comparing wild-type vs. Δlgt mutants

    • SILAC or TMT labeling for precise quantification of expression changes

    • Membrane fractionation protocols to enrich for lipoproteins

    • Analysis of different cellular compartments (membrane vs. secreted)

  • Lipoprotein enrichment strategies:

    • Palmitate analog metabolic labeling (e.g., alkyne-palmitate) followed by click chemistry

    • Detergent phase separation (Triton X-114) to concentrate hydrophobic proteins

    • Selective biotinylation of surface-exposed lipoproteins

    • Immunoprecipitation using anti-lipoprotein antibodies

  • Confirmation methodologies:

    • Mass spectrometry detection of lipid modifications

    • Western blotting for mobility shifts in SDS-PAGE (PAP vs. non-PAP fractions)

    • Detection of specific lipoprotein forms (e.g., UPLP, DGPLP)

    • Radiolabeling with tritiated palmitate to confirm lipid incorporation

  • Bioinformatic prediction:

    • Algorithm-based identification of potential lipoproteins using lipobox consensus sequences

    • Validation of predicted lipoproteins by experimental methods

    • Comparison across species to identify core and variable lipoproteomes

These approaches have revealed that lipoproteins constitute a substantial portion of secreted proteins in many bacteria and perform diverse functions including cell division, cellular infrastructure, protein localization, antibiotic resistance, nutrient adsorption, and signal transduction .

What are the common challenges in recombinant Lgt expression and purification, and how can they be addressed?

Researchers frequently encounter specific challenges when working with recombinant Lgt:

  • Low expression yields:

    • Optimize codon usage for expression host

    • Evaluate different expression vectors and promoter strengths

    • Test expression at reduced temperatures (16-20°C)

    • Consider fusion tags (MBP, SUMO) to enhance solubility

    • Evaluate different E. coli strains (C41/C43 for toxic membrane proteins)

  • Protein inactivity:

    • Ensure proper membrane insertion during expression

    • Include phospholipids during purification to maintain native environment

    • Optimize detergent selection through activity screening

    • Consider lipid nanodiscs or proteoliposomes for functional studies

    • Verify protein folding by circular dichroism or limited proteolysis

  • Purification difficulties:

    • Implement two-step detergent solubilization protocols

    • Screen detergent-to-protein ratios systematically

    • Add glycerol (10-20%) to purification buffers to enhance stability

    • Consider lipid addition during purification

    • Implement on-column detergent exchange strategies

  • Activity loss during storage:

    • Test flash-freezing in liquid nitrogen versus gradual freezing

    • Evaluate cryoprotectants (glycerol, sucrose)

    • Consider storage in partially purified membrane fractions

    • Determine optimal pH and salt conditions for stability

How can conflicting or unexpected results in Lgt research be interpreted and resolved?

Researchers investigating Lgt frequently encounter conflicting or unexpected results requiring careful interpretation:

  • Membrane topology discrepancies:

    • Previously conflicting predictions suggested either five or seven transmembrane domains

    • Resolution required multiple complementary approaches (alkaline phosphatase/beta lactamase fusions and SCAM)

    • Recommendation: Employ multiple independent techniques rather than relying solely on computational predictions

  • Localization inconsistencies:

    • Reports of cytoplasmic localization versus definitive membrane localization

    • Possible explanations include presence of paralogues or different detection methods

    • Recommendation: Use multiple localization methods (fractionation, microscopy, activity assays)

  • Mutation effect interpretation:

    • Loss of function may result from either catalytic inactivation or reduced expression

    • Critical to verify protein expression levels when evaluating mutant phenotypes

    • Recommendation: Always confirm expression levels by Western blotting when characterizing mutants

  • Essentiality variations:

    • Lgt is essential in most Gram-negative bacteria but dispensable in some Gram-positives

    • Different phenotypes observed across species require careful interpretation

    • Recommendation: Perform comparative genomics to identify potential compensatory mechanisms

When resolving conflicts, consider species differences, experimental conditions, detection methods, and the possibility of previously uncharacterized paralogues with redundant functions .

What are the most promising new methodologies for advancing Lgt research?

Several emerging technologies hold particular promise for advancing Lgt research:

  • Cryo-electron microscopy:

    • Potential for visualization of Lgt-substrate complexes in native-like environments

    • Opportunity to capture different conformational states during catalysis

    • Possibility to study larger complexes including interactions with other lipoprotein processing enzymes

  • Native mass spectrometry:

    • Characterization of intact membrane protein-lipid complexes

    • Determination of binding stoichiometry and affinity

    • Identification of transient reaction intermediates

  • High-throughput mutagenesis:

    • Deep mutational scanning to comprehensively map structure-function relationships

    • CRISPR-based genome-wide interaction screens to identify genetic interactions

    • Saturation mutagenesis of the active site to refine mechanistic understanding

  • Advanced imaging techniques:

    • Super-resolution microscopy to visualize Lgt localization in living cells

    • Single-molecule FRET to study dynamic conformational changes

    • Correlative light and electron microscopy for context-specific localization

  • Computational approaches:

    • Molecular dynamics simulations of Lgt within membrane environments

    • Machine learning prediction of substrate specificity

    • Quantum mechanical modeling of the reaction mechanism

What unresolved questions about Lgt represent the most significant gaps in current understanding?

Despite significant advances, several critical knowledge gaps remain:

  • Substrate recognition specificity:

    • Precise determinants beyond the lipobox that influence substrate selection

    • Potential for substrate-specific Lgt paralogues in some bacterial species

    • Mechanisms determining processing priority among multiple lipoprotein substrates

  • Regulation mechanisms:

    • How Lgt activity is regulated in response to environmental conditions

    • Potential post-translational modifications affecting Lgt function

    • Coordination with other lipoprotein processing enzymes (Lsp, Lnt)

  • Species-specific adaptations:

    • Structural and functional differences in Lgt across diverse bacterial phyla

    • Evolutionary basis for essentiality in Gram-negatives versus dispensability in some Gram-positives

    • Mechanistic basis for virulence attenuation in Lgt-deficient pathogens

  • Integration with cellular systems:

    • Relationship between Lgt and membrane homeostasis mechanisms

    • Coordination with phospholipid biosynthesis pathways

    • Interactions with protein translocation machinery for efficient substrate processing

  • Therapeutic potential:

    • Druggability assessment across different bacterial pathogens

    • Structure-based design of species-selective inhibitors

    • Potential for targeting Lgt to attenuate pathogenicity without selection for resistance

Addressing these questions will require interdisciplinary approaches combining structural biology, biochemistry, microbiology, and computational methods to develop a comprehensive understanding of this essential enzyme system .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.