Recombinant Promops centralis Cytochrome b (MT-CYB)

Shipped with Ice Packs
In Stock

Description

Molecular Structure and Function

Cytochrome b (MT-CYB) is encoded by the MT-CYB gene located in mitochondrial DNA (mtDNA). It is a 380-amino acid transmembrane protein with eight α-helical segments that anchor it to the inner mitochondrial membrane . Key structural and functional features include:

FeatureDetail
Gene LocationMitochondrial DNA (mtDNA), np 14747-15887 in humans
Protein LengthFull-length: 380 AA; Recombinant variants often express partial sequences (e.g., 1-176 AA)
Active SitesBinds heme groups (b₅₆₂ and b₅₆₆) for electron transfer
Post-Translational TagsN-terminal His tag for purification (e.g., CSB-CF654994PCAR)

Production and Expression Systems

Recombinant MT-CYB is produced using heterologous expression systems, primarily Escherichia coli, due to its scalability and cost efficiency .

Key Production Parameters

ParameterSpecification
Expression VectorpET, pGEX, or other bacterial plasmids
Tag SystemsHis tag, GST tag, or biotinylation tags (e.g., CSB-EP654994PCAR1-B)
Purity>90% via affinity chromatography
StorageTris-based buffer with 50% glycerol, stable at -20°C or -80°C

Example Product Codes

  • Full-length: CSB-CF654994PCAR (1-176 AA, His-tagged)

  • Partial sequences: CSB-YP654994PCAR1 (yeast-expressed), CSB-BP654994PCAR1 (baculovirus system)

Mitochondrial Disease Studies

Mutations in MT-CYB are linked to mitochondrial Complex III deficiencies, causing disorders such as:

  • Dilated cardiomyopathy (DCM): Associated with m.14757T>C (M4T) mutation, impairing Complex III assembly .

  • Histiocytoid cardiomyopathy: Linked to G251D substitution .

  • MELAS-like syndrome: m.14864T>C mutation causes stroke-like episodes and neuropathy .

Recombinant MT-CYB enables functional studies of these mutations in vitro.

Pathogenic Mutation Analysis

A 2021 study identified the m.14757T>C variant in a patient with DCM and Complex III deficiency:

ParameterResult
Mutation ImpactMethionine→Threonine substitution at position 4 (M4T)
Functional Defect70% reduction in Complex III activity in skeletal muscle
Clinical PhenotypeLeft ventricular dilatation, arrhythmias, and heart failure

Therapeutic Target Exploration

Recombinant MT-CYB aids in screening compounds that stabilize Complex III, with potential applications in metabolic disorders .

Challenges and Future Directions

  • Production Limitations: Full-length MT-CYB expression remains challenging due to hydrophobicity .

  • Clinical Translation: Heteroplasmy levels in mtDNA complicate genotype-phenotype correlations .

Future research may focus on transgenic models to validate mutation pathogenicity and develop gene-editing therapies .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and agreed upon in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
MT-CYB; COB; CYTB; MTCYB; Cytochrome b; Complex III subunit 3; Complex III subunit III; Cytochrome b-c1 complex subunit 3; Ubiquinol-cytochrome-c reductase complex cytochrome b subunit; Fragment
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-176
Protein Length
full length protein
Species
Promops centralis (Big crested mastiff bat)
Target Names
Target Protein Sequence
MTNIRKSHPLMKIVNDAFIDLPAPSNISWWWNFGSLLGVCLMMQILTGLFLAMHYTSDTA TAFNSVTHICRDVNYGWLLRYLHANGASMFFICLYLHIGRGLYYGSYTYTETWNVGIILL FAVMATAFMGYVLPWGQMSSWGATVITNLLSAIPYIGTDLVGWIWGGFSVDKATLT
Uniprot No.

Target Background

Function
Recombinant *Promops centralis* Cytochrome b (MT-CYB) is a component of the ubiquinol-cytochrome c reductase complex (Complex III or cytochrome b-c1 complex) within the mitochondrial respiratory chain. This complex facilitates electron transfer from ubiquinol to cytochrome c, contributing to the generation of a proton gradient across the mitochondrial membrane. This gradient is essential for ATP synthesis.
Protein Families
Cytochrome b family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the function of cytochrome b in mitochondrial respiration?

Cytochrome b serves as a key component of complex III (ubiquinol-cytochrome c reductase) in the mitochondrial respiratory chain. It plays a crucial role in the electron transport process, specifically mediating electron transfer from ubiquinol to cytochrome c, which contributes to the generation of a proton gradient that ultimately powers ATP synthesis. Unlike other components of complex III, cytochrome b is uniquely encoded by the mitochondrial genome rather than nuclear DNA, making it particularly valuable for evolutionary studies and mitochondrial function research . During oxidative phosphorylation, cytochrome b participates in the step-by-step transfer of electrons through complex III, a process essential for cellular energy production in aerobic organisms.

How does Promops centralis MT-CYB differ structurally from human MT-CYB?

While the search results don't specifically compare Promops centralis MT-CYB to human MT-CYB, general cytochrome b analysis would involve examining key structural differences in amino acid sequences, particularly at conserved functional sites. The MT-CYB gene is known to have multiple conserved regions across species, with certain amino acid positions being critical for proper electron transport function. For comprehensive structural comparison, researchers should perform sequence alignment of both proteins, focusing on key functional domains such as the Qo and Qi sites (ubiquinone binding sites) and transmembrane helices. Analysis would also examine hydrophobic regions that anchor the protein in the inner mitochondrial membrane and evaluate the conservation of proline residues, such as those around position 208, which may be structurally significant as indicated by antibody binding sites .

What are the most effective expression systems for producing recombinant MT-CYB protein?

For recombinant MT-CYB expression, bacterial systems like E. coli have limitations due to the highly hydrophobic nature of cytochrome b and its multiple transmembrane domains. More effective approaches include using eukaryotic expression systems such as yeast (S. cerevisiae or P. pastoris) which possess the cellular machinery for proper folding and insertion of membrane proteins. For functional studies requiring proper complex III assembly, mammalian cell lines (HEK293 or CHO cells) may provide more native-like post-translational modifications. Researchers should consider incorporating affinity tags (His-tag or FLAG-tag) at positions that don't interfere with protein folding or function, and codon optimization based on the expression host. When designing expression constructs, include appropriate signal sequences for mitochondrial targeting and consider using inducible promoters to control expression levels, as overexpression of membrane proteins can be toxic to host cells.

What methods are most reliable for confirming the identity of recombinant MT-CYB protein?

Authentication of recombinant MT-CYB requires a multi-faceted approach. Western blotting using specific antibodies, such as those directed against residues surrounding Pro208 as mentioned in the research data, provides initial confirmation of protein expression at the expected molecular weight (approximately 26 kDa) . Mass spectrometry offers more definitive identification through peptide mass fingerprinting and sequence analysis. Functional assays measuring electron transport activity within reconstituted systems or isolated mitochondria can confirm biological activity. For structural confirmation, circular dichroism spectroscopy helps verify proper protein folding, while absorption spectroscopy can identify characteristic spectral features of properly incorporated heme groups. When mutations or variants are being studied, DNA sequencing of the expression construct prior to protein production is essential to confirm the correct sequence has been maintained throughout the cloning process.

How can researchers effectively isolate functional recombinant MT-CYB for biochemical studies?

Isolation of functional recombinant MT-CYB requires specialized techniques due to its hydrophobic nature and membrane integration. Begin with gentle cell lysis using detergents (such as n-dodecyl β-D-maltoside or digitonin) that preserve protein structure and complex integrity. For recombinant proteins with affinity tags, use immobilized metal affinity chromatography (IMAC) with optimized detergent concentrations in all buffers. Size exclusion chromatography can further purify the protein while determining its oligomeric state. To maintain functionality, include appropriate phospholipids in purification buffers and consider using nanodisc technology or liposome reconstitution for stable storage of the purified protein. Quality control should include assessing protein purity via SDS-PAGE, confirming heme incorporation through absorption spectroscopy (examining characteristic peaks at approximately 562-564 nm for reduced cytochrome b), and verifying electron transfer capability using artificial electron donors and acceptors in activity assays.

What are the most sensitive methods for detecting MT-CYB mutations in research samples?

Detection of MT-CYB mutations requires high-sensitivity approaches, particularly given the heteroplasmic nature of many mitochondrial mutations. Next-generation sequencing (NGS) provides the most comprehensive analysis, capable of detecting low-level heteroplasmy with appropriate depth of coverage. For targeted mutation analysis, several techniques offer varying advantages: TaqMan allelic discrimination assays provide quantitative analysis of specific known variants as demonstrated in male infertility studies ; Sanger sequencing remains valuable for confirming mutations and is considered the gold standard for validation ; restriction fragment length polymorphism (RFLP) analysis offers a cost-effective approach for known mutations that alter restriction sites. For novel mutation discovery, whole mitochondrial genome sequencing followed by bioinformatic analysis comparing to reference sequences is recommended. Functional prediction tools such as PolyPhen can help assess the potential pathogenicity of identified variants, as exemplified by the analysis of the m.14757T>C variant in dilated cardiomyopathy research .

How can researchers accurately measure the electron transport function of recombinant MT-CYB?

Accurate measurement of MT-CYB electron transport function requires multiple complementary techniques. For complex III activity assessment, spectrophotometric assays tracking cytochrome c reduction in the presence of reduced ubiquinol (typically ubiquinol-2 or ubiquinol-10) provide quantitative kinetic data. Oxygen consumption measurements using high-resolution respirometry with pathway-specific substrates and inhibitors can evaluate the protein's function within the complete respiratory chain. Membrane potential assays using fluorescent dyes (such as JC-1 or TMRM) can assess the protein's contribution to proton translocation. For more detailed mechanistic studies, stopped-flow spectroscopy enables measurement of rapid electron transfer rates between specific redox centers. When comparing wild-type and mutant proteins, researchers should establish standardized conditions addressing factors like temperature, pH, substrate concentrations, and the presence of specific inhibitors like antimycin A or myxothiazol that bind to different sites within cytochrome b, providing insights into the functional consequences of specific mutations.

What controls are essential when studying recombinant MT-CYB in experimental systems?

Rigorous control measures are critical for valid MT-CYB research. Positive controls should include commercially validated wild-type cytochrome b protein or well-characterized cell lines with normal MT-CYB expression. Negative controls should incorporate systems lacking MT-CYB or containing known non-functional variants. When studying specific mutations, parallel analysis of the wild-type protein processed identically is essential. For heterologous expression studies, empty vector controls and host cells without the recombinant protein should be evaluated to distinguish host responses from protein-specific effects. Specificity controls using MT-CYB inhibitors (antimycin A for Qi site or myxothiazol for Qo site) help confirm that observed activities are genuinely attributable to cytochrome b function. In mutation studies, include control variants that maintain amino acid properties (e.g., hydrophobicity, charge) to distinguish between effects caused by specific residue changes versus general disruption of protein properties. Statistical validation through multiple experimental replicates and appropriate statistical tests is necessary for all quantitative measurements.

How do MT-CYB mutations affect the assembly and stability of mitochondrial complex III?

MT-CYB mutations can significantly disrupt complex III assembly and stability through multiple mechanisms. Mutations that alter amino acid properties, such as replacing hydrophobic residues with polar ones (like the M4T substitution observed in the m.14757T>C variant), can disrupt protein folding and membrane integration . Structural studies indicate that cytochrome b forms the central core around which other complex III subunits assemble, so mutations can prevent proper association with partner proteins, leading to accumulation of assembly intermediates. The stability of fully assembled complexes may be compromised if mutations affect intermolecular interactions between subunits. Certain mutations result in premature termination, producing truncated cytochrome b proteins that cannot fulfill their structural role, as seen in several mitochondrial myopathy cases . To investigate these effects, researchers should employ blue native polyacrylamide gel electrophoresis (BN-PAGE) to analyze complex integrity, pulse-chase experiments to assess assembly kinetics, and protease sensitivity assays to evaluate structural stability. Complementary approaches include measuring the levels of other complex III components to detect compensatory responses or degradation of unassembled subunits.

What is the relationship between MT-CYB polymorphisms and adaptation to different ecological niches in bat species?

The MT-CYB gene serves as a valuable marker for studying evolutionary adaptation across bat species occupying diverse ecological niches. In chiropterans like Promops centralis, cytochrome b polymorphisms may reflect adaptations to different metabolic demands associated with varied flight patterns, feeding strategies, and environmental temperatures. Selective pressures on energy metabolism likely drive the conservation or divergence of specific functional domains within cytochrome b. Research approaches should include comparative sequence analysis across bat species from different habitats, focusing on non-synonymous substitutions that might alter protein function. Analysis of selection signatures (dN/dS ratios) can identify regions under positive selection, potentially indicating adaptive evolution. Researchers should correlate specific amino acid changes with ecological parameters such as altitude adaptation, which affects oxygen availability and potentially drives adaptations in respiratory chain components. Functional studies comparing electron transfer efficiency across variants found in different bat populations can provide experimental evidence for adaptive significance of observed polymorphisms. This research has broader implications for understanding mitochondrial adaptations in mammals with high metabolic demands and specialized ecological adaptations.

How can researchers differentiate between pathogenic MT-CYB mutations and benign polymorphisms?

Distinguishing pathogenic MT-CYB mutations from benign polymorphisms requires a comprehensive evaluation framework integrating multiple lines of evidence. Conservation analysis across species is a critical starting point—variants affecting highly conserved residues, like the cysteine to arginine substitution at position 40 described in the MELAS-like case, are more likely to be pathogenic . Biochemical consequence assessment should examine whether the amino acid substitution significantly changes properties such as hydrophobicity, charge, or size. Functional validation through measures of enzyme activity is essential, as demonstrated in the complex III deficiency observed in muscle biopsies from patients with suspected pathogenic variants . Population frequency data provides context—variants absent in large control populations, such as the m.14757T>C mutation not found in 100 healthy controls or 2,704 normal individuals from diverse backgrounds, are more likely pathogenic . Heteroplasmy analysis is also informative, as pathogenic mutations often show tissue-specific heteroplasmy levels correlating with clinical manifestations, exemplified by the m.14864T>C mutation found in multiple tissues of an affected patient but absent in maternal tissues . Predictive algorithms like PolyPhen provide computational support, though they should never be used as the sole determinant of pathogenicity.

What is the significance of MT-CYB in phylogenetic studies of chiropteran evolution?

MT-CYB serves as a powerful marker for phylogenetic studies of bat evolution due to several unique characteristics. Its maternal inheritance pattern without recombination provides a clear evolutionary lineage uncompromised by genetic recombination. The gene exhibits an optimal mutation rate for resolving relationships at various taxonomic levels—it evolves faster than nuclear genes but shows enough conservation to allow alignment across distant taxa. Through comparative analysis of MT-CYB sequences from diverse bat species, researchers can reconstruct evolutionary relationships, estimate divergence times, and identify instances of convergent evolution in response to similar ecological pressures. For robust phylogenetic analysis, researchers should employ multiple sequence alignment with appropriate gap penalties, select evolutionary models that account for the observed patterns of nucleotide substitution (typically using model testing approaches), and implement both maximum likelihood and Bayesian inference methods to ensure consistent tree topology. Researchers studying Promops centralis should be particularly attentive to third codon position saturation, which can occur in MT-CYB and potentially confound deep evolutionary relationships. Combining MT-CYB data with other mitochondrial and nuclear markers provides the most comprehensive phylogenetic framework.

How do MT-CYB mutations contribute to human disease pathogenesis?

MT-CYB mutations contribute to disease pathogenesis through several mechanisms that disrupt cellular energy production. Primary among these is impaired complex III assembly and function, resulting in reduced oxidative phosphorylation capacity and ATP synthesis. This deficiency particularly affects high-energy demanding tissues such as muscle, heart, and brain. The search results demonstrate this in multiple clinical contexts: patients with mitochondrial complex III deficiency typically present with muscle weakness, exercise intolerance, and in severe cases, involvement of other organ systems including liver, kidneys, heart, and brain . Specific mutations produce distinct clinical phenotypes—the novel m.14864T>C mutation changing a conserved cysteine to arginine was associated with migraines, epilepsy, sensorimotor neuropathy, and stroke-like episodes reminiscent of MELAS syndrome . Additionally, MT-CYB mutations increase reactive oxygen species (ROS) production due to electron leakage from the compromised respiratory chain, causing oxidative damage to cellular components. The m.14757T>C mutation, resulting in a methionine to threonine substitution, was linked to dilated cardiomyopathy, highlighting the tissue-specific manifestations of mitochondrial dysfunction . The heteroplasmic nature of many MT-CYB mutations (varying proportions of mutant mitochondria across tissues) contributes to the complex and varied clinical presentations observed.

What insights can comparative studies of Promops centralis MT-CYB provide for human mitochondrial disease research?

Comparative studies of Promops centralis MT-CYB can provide valuable insights for human mitochondrial disease research through evolutionary and functional perspectives. Bats' exceptional longevity despite high metabolic rates suggests they may possess adaptations in their respiratory chain components, including cytochrome b, that enhance efficiency or reduce oxidative damage. By identifying highly conserved regions between bat and human MT-CYB, researchers can pinpoint functionally critical domains where mutations are likely pathogenic. Conversely, naturally occurring variations in bat cytochrome b that would be detrimental in humans may reveal compensatory mechanisms that could inform therapeutic approaches. Research should focus on comparative functional studies examining ROS production, electron transfer efficiency, and complex III stability between bat and human variants. Structural analysis comparing the interaction interfaces between cytochrome b and other complex III components across species could identify critical regions for complex assembly. Investigation of bat-specific post-translational modifications or interactions with chaperone proteins might reveal protective mechanisms that could be therapeutically targeted. Additionally, examining regions of the cytochrome b protein that have undergone positive selection in bats but remain conserved in humans could highlight adaptively significant domains relevant to understanding human MT-CYB-related diseases.

What are the most effective strategies for modeling MT-CYB mutations in experimental systems?

Developing accurate experimental models for MT-CYB mutations requires strategic selection of systems that recapitulate key aspects of mitochondrial biology while allowing manipulations not possible in patient samples. Cybrid (cytoplasmic hybrid) cell lines represent a gold standard approach, created by fusing patient-derived mitochondria (containing MT-CYB mutations) with cells depleted of mitochondrial DNA. This system maintains the nuclear genetic background while isolating the effects of mitochondrial mutations. For precise genetic manipulation, CRISPR-based approaches targeting mitochondria (mitoTALENs or base editors with mitochondrial localization signals) enable introduction of specific MT-CYB mutations. Animal models with altered MT-CYB include zebrafish, which offer advantages of optical transparency for mitochondrial imaging and rapid development, and mouse models with introduced mutations in nuclear-encoded complex III components that interact with cytochrome b. In all model systems, researchers should verify mutation heteroplasmy levels, confirm complex III assembly status using BN-PAGE, assess mitochondrial respiratory capacity through oxygen consumption measurements, and evaluate tissue-specific phenotypes that reflect human disease manifestations. When studying novel mutations like those identified in patients with dilated cardiomyopathy, validation should include confirming the absence of the variant in control populations and applying prediction algorithms to assess potential pathogenicity .

How can studies of MT-CYB inform the development of therapies for mitochondrial disorders?

Research on MT-CYB provides multiple avenues for therapeutic development targeting mitochondrial disorders. By identifying critical functional domains and interaction surfaces within cytochrome b, researchers can design small molecule compounds that stabilize complex III assembly or function in the presence of mutations. Studies of natural variants across species, including bats like Promops centralis, may reveal compensatory mechanisms that could be therapeutically mimicked. Several therapeutic approaches emerging from MT-CYB research include: alternative oxidase (AOX) expression to bypass complex III defects by providing an alternative electron flow path; mitochondrially-targeted antioxidants to mitigate increased ROS production associated with MT-CYB mutations; compounds that enhance mitochondrial biogenesis through activation of PGC-1α to compensate for deficient energy production; and metabolic bypass strategies using alternative energy substrates that feed into the electron transport chain beyond the complex III defect. For heteroplasmic mutations, mitochondrial-targeted nucleases can selectively eliminate mutant mitochondrial DNA, shifting heteroplasmy levels below the threshold for disease expression. Therapeutic testing should utilize the models discussed previously, with outcome measures including complex III activity, ATP production, ROS levels, and tissue-specific functional improvements. Understanding the biochemical consequences of specific MT-CYB mutations is essential for selecting the most appropriate therapeutic approach for individual patients.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.