Recombinant Propionibacterium acnes ATP synthase subunit b (atpF)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for custom preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional fees.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted as needed.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If a specific tag type is required, please inform us; we will prioritize its development.
Synonyms
atpF; PPA1243; ATP synthase subunit b; ATP synthase F(0 sector subunit b; ATPase subunit I; F-type ATPase subunit b; F-ATPase subunit b
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-184
Protein Length
full length protein
Species
Propionibacterium acnes (strain KPA171202 / DSM 16379)
Target Names
atpF
Target Protein Sequence
MNILEMDLGPLAPEHPIEIIVGVILVLLLTWLIAKAVVPRFEKLYEERTETIQGGIERAE RAQAEAKAALEKYQAQLASARDEAAQIRDDAKSQGAQIIAEMRANAQEEADRITERANAQ IQAERDQAVREVRAEIGGLATTLASRIVGESLQDDQRVQATVDRFLSSLADEPSASNSRT VNRA
Uniprot No.

Target Background

Function
F(1)F(0) ATP synthase synthesizes ATP from ADP using a proton or sodium gradient. This enzyme comprises two domains: the F(1) catalytic core (extramembranous) and the F(0) membrane proton channel. These domains are connected by a central and peripheral stalk. ATP synthesis in the F(1) catalytic domain is coupled to proton translocation via a rotary mechanism involving the central stalk subunits. This protein is a component of the F(0) channel and forms part of the peripheral stalk, linking F(1) to F(0).
Database Links

KEGG: pac:PPA1243

STRING: 267747.PPA1243

Protein Families
ATPase B chain family
Subcellular Location
Cell membrane; Single-pass membrane protein.

Q&A

What is the taxonomic context of Propionibacterium acnes and how does it affect atpF research?

Propionibacterium acnes has undergone significant taxonomic reclassification in recent years. It was initially classified as Bacillus acnes, then Corynebacterium acnes, and more recently renamed as Cutibacterium acnes based on phylogenetic analyses . The genus Cutibacterium comprises several cutaneous species including C. acnes, C. avidum, C. granulosum, and C. humerusii . Additionally, C. acnes has been further subdivided into subspecies such as C. acnes subsp. defendens and C. acnes subsp. elongatum . This taxonomic diversity is important to consider when working with the ATP synthase subunit b, as strain variations may affect protein structure, function, and expression systems. Researchers should verify the exact strain taxonomy when designing experiments to ensure proper genomic annotation and cross-reference with published studies.

How does P. acnes cellular structure and metabolism relate to ATP synthase function?

P. acnes possesses a unique cell wall structure compared to other Gram-positive bacteria. Its cell envelope contains phosphatidylinositol, triacylglycerol, and various lipids, while its peptidoglycan contains L-diaminopelic acid and D-alanine . The bacterium's metabolism is characterized by its ability to produce propionic acid via anaerobic catabolism, which is reflected in its previous classification . These structural and metabolic characteristics create a distinct cellular environment in which the ATP synthase operates. The ATP synthase complex, including the b subunit, plays a crucial role in energy production by coupling proton translocation across the membrane with ATP synthesis. Understanding these relationships is essential for researchers studying atpF function, particularly when designing functional assays or interpreting experimental results in different growth conditions.

What are the most effective expression systems for recombinant P. acnes atpF protein?

The expression of recombinant P. acnes proteins, including atpF, presents several challenges due to the anaerobic nature and unique metabolic requirements of this organism. Based on research with other P. acnes proteins, several expression systems have shown success:

  • E. coli expression systems: Heterologous expression in E. coli has been successfully used for P. acnes proteins, as demonstrated in studies with linoleic acid isomerase (LAI) . For atpF, cold-inducible expression vectors like pCold (similar to the pCold-lai-p-gfp used for LAI) may be effective, especially when protein folding is a concern .

  • Yeast expression systems: Surface display in yeast has been utilized for P. acnes proteins, offering advantages for proteins requiring post-translational modifications. This approach has been successful with LAI from P. acnes, where fusion to the egfp gene allowed visualization of expression and localization .

When selecting an expression system, researchers should consider the protein's hydrophobicity, potential membrane association, and requirements for cofactors or post-translational modifications. For membrane proteins like ATP synthase subunit b, detergent solubilization strategies may be necessary during purification.

What purification strategies optimize yield and maintain functionality of recombinant atpF?

Purification of recombinant P. acnes atpF requires careful consideration of the protein's structural and functional integrity. A recommended multi-step purification protocol includes:

  • Initial clarification: After cell lysis, centrifugation at 10,000-15,000g to separate soluble from insoluble fractions.

  • Affinity chromatography: His-tag or other fusion tags facilitate initial purification. Consider using mild detergents (0.1-0.5% DDM or LDAO) if the protein exhibits membrane association properties.

  • Ion exchange chromatography: Further purification based on the predicted isoelectric point of atpF.

  • Size exclusion chromatography: Final polishing step to isolate monomeric protein from aggregates.

Throughout purification, maintaining buffer conditions that preserve protein structure is essential. For atpF, which functions as part of a larger complex, adding stabilizing agents such as glycerol (10-15%) and monitoring protein stability with dynamic light scattering can improve outcomes. Researchers should verify protein functionality after purification through ATP hydrolysis assays or binding studies with other ATP synthase subunits.

How can researchers effectively assess the structural characteristics of recombinant P. acnes atpF?

Structural analysis of recombinant P. acnes atpF can be approached through multiple complementary techniques:

  • X-ray crystallography: While challenging for membrane-associated proteins, this provides the highest resolution structural data. Successful crystallization may require removal of flexible regions or fusion with crystallization chaperones.

  • Cryo-electron microscopy: Increasingly useful for membrane proteins, especially when examining atpF in the context of the complete ATP synthase complex.

  • Circular dichroism spectroscopy: Provides information about secondary structure content and stability under varying conditions (pH, temperature, ionic strength).

  • NMR spectroscopy: Suitable for analyzing dynamics and interactions, particularly for specific domains of atpF.

  • Homology modeling: Computational approaches based on structures of ATP synthase b subunits from related organisms can provide preliminary structural insights.

When designing structural studies, researchers should consider the native lipid environment of atpF, as P. acnes has a unique cell envelope composition that may influence protein folding and stability . Nanodiscs or liposome reconstitution may better mimic the native environment than detergent micelles alone.

What methods can determine the interaction partners of atpF within the ATP synthase complex?

Understanding the interaction network of atpF within the ATP synthase complex is crucial for elucidating its function. Several complementary approaches can identify and characterize these interactions:

  • Co-immunoprecipitation: Using antibodies against atpF or potential partner proteins to pull down complexes from cellular lysates.

  • Cross-linking mass spectrometry: Chemical cross-linking followed by MS analysis can identify proteins in close proximity to atpF.

  • Bacterial two-hybrid systems: Particularly useful for screening multiple potential interactions.

  • Surface plasmon resonance (SPR): Provides quantitative binding kinetics between atpF and purified partner proteins.

  • Isothermal titration calorimetry (ITC): Offers thermodynamic parameters of binding interactions.

For functional studies, researchers can develop an in vitro reconstitution system combining recombinant atpF with other ATP synthase subunits to measure assembly efficiency and ATP synthesis activity. This approach would be similar to methods used in studying the mechanisms of other P. acnes enzymes like polyunsaturated fatty acid isomerase .

What are the most effective methods for gene modification studies of atpF in P. acnes?

Genetic manipulation of P. acnes requires specialized approaches due to its anaerobic growth requirements and relatively low transformation efficiency. For atpF studies, several strategies have proven effective:

  • Directed evolution: Similar to approaches used for LAI in P. acnes, researchers can employ directed evolution to generate atpF variants with altered properties . This involves creating a mutant library followed by screening for desired characteristics.

  • Site-directed mutagenesis: For targeted modification of specific residues within atpF. This approach is particularly valuable when structural information suggests residues critical for function or interaction.

  • Homologous recombination: For chromosomal integration or gene replacement studies. This requires carefully designed vectors with homology arms flanking the atpF gene.

  • CRISPR-Cas9 systems: Emerging as a powerful tool for genetic manipulation in various bacteria, adapted protocols for P. acnes can enable precise genome editing.

For all genetic manipulation studies, researchers should consider P. acnes strain differences, as multilocus sequence typing has revealed distinct evolutionary lineages with varying gene contents that may affect experimental outcomes . The Aarhus MLST scheme (http://pacnes.mlst.net/) offers enhanced resolution for strain typing and can help researchers select appropriate strains for their studies .

How can functional consequences of atpF mutations be effectively assessed?

Evaluating the functional impact of atpF mutations requires comprehensive approaches that address both protein-level and cellular-level effects:

  • Protein-level assays:

    • ATP hydrolysis activity measurements using purified recombinant protein

    • Binding affinity studies with other ATP synthase subunits

    • Structural stability assessments using thermal shift assays

    • Proton translocation assays in reconstituted proteoliposomes

  • Cellular-level assays:

    • Growth rate and viability analysis under various nutrient conditions

    • Membrane potential measurements using fluorescent probes

    • Cellular ATP content quantification

    • Transcriptomic and proteomic profiling to identify compensatory responses

When designing mutation studies, researchers should consider the evolutionary conservation of atpF residues across different bacterial species, as well as the specific adaptations in P. acnes that may relate to its unique ecological niche on human skin . Comparative analysis with other strains or subspecies of P. acnes can provide additional context for interpreting the functional significance of specific residues or domains.

How can proteomics approaches enhance our understanding of atpF regulation in P. acnes?

Proteomics offers powerful tools for investigating atpF regulation within the broader context of P. acnes metabolism and adaptation:

  • Quantitative proteomics: Label-free or isotope-labeled approaches can track changes in atpF expression across different growth conditions, revealing regulatory patterns.

  • Post-translational modification analysis: Mass spectrometry-based methods can identify modifications that regulate atpF function, such as phosphorylation, acetylation, or proteolytic processing.

  • Protein-protein interaction networks: Techniques like BioID or proximity labeling can map the interaction landscape of atpF beyond the ATP synthase complex.

  • Spatial proteomics: Subcellular fractionation combined with proteomics can determine the localization patterns of atpF and how they change under different conditions.

A comprehensive proteomics approach, similar to the one used in studying LAI regulation , would involve comparing wild-type and mutant strains under various environmental conditions. This could reveal how atpF expression correlates with other metabolic pathways and stress responses in P. acnes. For example, research on LAI identified 104 differentially expressed proteins between mutant and control strains, with significant enrichment in pathways such as galactose metabolism, phosphotransferase systems, and starch metabolism . Similar analysis of atpF regulation could identify unexpected metabolic connections.

What role might atpF play in P. acnes virulence and pathogenicity?

The potential contribution of atpF to P. acnes virulence presents an important research direction, especially given the bacterium's role in various infections:

  • Biofilm formation: ATP synthase function may influence energy availability for biofilm development, which is critical for P. acnes pathogenicity in device-associated infections .

  • Stress adaptation: atpF and ATP synthesis could be crucial for surviving host defense mechanisms, including oxidative stress and nutrient limitation.

  • Virulence factor regulation: Energy metabolism through ATP synthase may coordinate with expression of virulence factors that enable P. acnes to adapt to different ecological niches .

  • Host-pathogen interaction: Potential immunomodulatory effects if atpF or its fragments are exposed to host immune cells.

Research methodologies to investigate these aspects include:

  • Comparative studies of atpF sequence and expression between commensal and disease-associated P. acnes lineages

  • Animal models of P. acnes infection with wild-type and atpF-modified strains

  • Host cell response studies using recombinant atpF protein

  • Transcriptomic analysis of host-pathogen interactions

Understanding the role of atpF in virulence could provide new insights into P. acnes pathogenicity mechanisms, which are relevant to various conditions including acne vulgaris, biofilm-associated infections, endophthalmitis, and potentially prostate cancer .

What are common challenges in recombinant atpF expression and how can they be addressed?

Researchers frequently encounter several challenges when working with recombinant P. acnes atpF:

  • Protein solubility issues: As a potential membrane-associated protein, atpF may form inclusion bodies during recombinant expression.

    • Solution: Test multiple expression conditions (temperature, induction concentration, time), use solubility-enhancing fusion partners (SUMO, MBP), or explore membrane protein-specific expression systems.

  • Protein instability: ATP synthase subunits often destabilize when expressed individually outside their complex.

    • Solution: Co-express with partner subunits, optimize buffer conditions with stabilizing agents, or use nanodiscs/liposomes for membrane proteins.

  • Low expression yield: P. acnes genes may have codon usage biases incompatible with common expression hosts.

    • Solution: Optimize codon usage for the expression host, use strong but controllable promoters, or test expression in multiple systems.

  • Protein activity loss during purification: Harsh purification conditions may denature the protein.

    • Solution: Use mild detergents for membrane proteins, include stabilizing agents throughout purification, and minimize exposure to extreme conditions.

When troubleshooting expression issues, learning from studies of other P. acnes proteins can be valuable. For example, researchers successfully expressed P. acnes LAI by creating fusion constructs with reporter proteins like GFP and optimizing induction conditions .

How can researchers validate the authenticity and functionality of purified recombinant atpF?

Ensuring that purified recombinant atpF is correctly folded and functional requires multiple validation approaches:

  • Structural integrity assessment:

    • Circular dichroism to confirm secondary structure content

    • Size exclusion chromatography to verify monodispersity

    • Limited proteolysis to probe folding quality

    • Thermal shift assays to assess stability

  • Functional validation:

    • ATP binding assays (e.g., using fluorescent ATP analogs)

    • Interaction studies with other ATP synthase subunits

    • Assembly assays into partial or complete ATP synthase complexes

    • Proton translocation measurements in reconstituted systems

  • Authenticity verification:

    • Mass spectrometry to confirm protein identity and detect post-translational modifications

    • N-terminal sequencing to verify correct processing

    • Immunoblotting with specific antibodies

    • Activity comparison with native protein (if available)

For comparative studies, researchers should consider P. acnes strain differences, as studies have shown significant genomic and phenotypic diversity among clinical isolates . Using well-characterized reference strains or clinical isolates with known sequences can provide important benchmarks for recombinant protein validation.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.