Recombinant Propionibacterium acnes Protein CrcB homolog 1 (crcB1)

Shipped with Ice Packs
In Stock

Description

Introduction

Recombinant Propionibacterium acnes Protein CrcB homolog 1 (crcB1) is a genetically engineered protein produced to study its structural and functional roles in bacterial physiology. CrcB1 is a putative fluoride ion transporter implicated in microbial stress response and survival . Its recombinant form enables biochemical and immunological research, particularly in understanding P. acnes pathogenicity and interactions with host systems .

Production and Purification

Recombinant crcB1 is typically expressed in E. coli systems for high yield and purity:

  • Expression System: E. coli with N-terminal His tag for affinity chromatography .

  • Purification: Tris/PBS-based buffer with 6% trehalose (pH 8.0), followed by lyophilization .

  • Purity: >90% as verified by SDS-PAGE .

  • Storage: Lyophilized powder stable at -20°C/-80°C; reconstitution in sterile water recommended .

Immunological Studies

  • Recombinant crcB1 is used in ELISA kits to investigate antibody responses in P. acnes-associated diseases (e.g., acne vulgaris, sarcoidosis) .

  • Anti-crcB1 antibodies have been tested for modulating TLR-2-mediated inflammatory pathways, though results remain preliminary .

Genomic Context

  • The crcB1 gene (locus tag PPA0770) is conserved across P. acnes phylotypes, including acne-associated strains (RT5, IA-2) .

  • Antibiotic-resistant strains (e.g., HL411PA1) show genomic islands near crcB1, suggesting horizontal gene transfer .

Comparative Analysis

FeatureP. acnes crcB1 (Q6A9P0)M. paratuberculosis crcB1 (P61392)
Length143 residues132 residues
Expression HostE. coliE. coli
Proposed FunctionFluoride transportFluoride transport
Pathogenic RelevanceAcne, biofilm formation Johne’s disease

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
crcB1; PPA0770; Putative fluoride ion transporter CrcB 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-143
Protein Length
full length protein
Species
Propionibacterium acnes (strain KPA171202 / DSM 16379)
Target Names
crcB1
Target Protein Sequence
MAMRSGFLDRRPVLVGLVFLGGCLGTLIRSVIAHAWPSRADGVPWGTLAINLVGAFVLAT LLELLVHAGPDRGVRRAVRLCIGTGLLGGFTTYSALTVEAGQRVMSGQWLWGIAYLLTSV AAGALLAWVVIAAVRCVMGKRSS
Uniprot No.

Target Background

Function
Crucial for reducing intracellular fluoride concentration and its associated toxicity.
Database Links

KEGG: pac:PPA0770

STRING: 267747.PPA0770

Protein Families
CrcB (TC 9.B.71) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is crcB1 in Propionibacterium acnes and how does it differ from CAMP factors?

While CAMP (Christie-Atkins-Munch-Peterson) factors are well-characterized virulence factors in P. acnes with roles in inflammation and cytotoxicity, crcB1 appears to be a distinct protein. Based on homology studies in other bacteria, crcB proteins are typically associated with fluoride resistance mechanisms, functioning as fluoride channels or transporters that protect cells from fluoride toxicity . Unlike CAMP factors, which show approximately 32% sequence homology to the cohemolytic CAMP factor of Streptococcus agalactiae and contribute to virulence through cytotoxicity to keratinocytes and macrophages , crcB1 likely has different cellular functions related to ion homeostasis.

What experimental approaches can be used to characterize the function of crcB1 in P. acnes?

Characterization of crcB1 function should employ multiple complementary approaches:

  • Genetic knockout studies: Using homologous recombination systems similar to the λ-red system described for E. coli . This requires:

    • Design of appropriate homology arms

    • Verification of knockout through PCR and sequencing

    • Phenotypic assessment of the knockout strain

  • Complementation assays: Expression of crcB1 in knockout strains to confirm phenotype rescue, particularly testing for fluoride sensitivity .

  • Heterologous expression studies: Expression in model organisms like E. coli ΔcrcB to determine if P. acnes crcB1 can rescue fluoride sensitivity (similar to the technique described in the supplementary information) .

  • Structural characterization: Purification of recombinant protein followed by structural analysis to identify potential ion channel domains.

What are the optimal conditions for expressing recombinant P. acnes crcB1 protein?

Based on methodologies used for other P. acnes recombinant proteins:

  • Expression system selection:

    • E. coli BL21(DE3) is commonly used for recombinant P. acnes proteins

    • Consider codon optimization for E. coli expression

    • Assess both N- and C-terminal tagging strategies (His-tag being most common)

  • Induction conditions:

    • Test IPTG concentrations ranging from 0.1-1.0 mM

    • Evaluate expression at different temperatures (16°C, 25°C, 37°C)

    • Optimize induction time (4-24 hours)

  • Buffer optimization:

    • Consider membrane protein extraction buffers if crcB1 shows predicted transmembrane domains

    • Test various detergents for solubilization if protein forms inclusion bodies

What purification strategy would yield the highest purity recombinant crcB1 for structural studies?

A multi-step purification process is recommended:

  • Initial capture:

    • Immobilized metal affinity chromatography (IMAC) using Ni-NTA for His-tagged protein

    • Consider on-column refolding if protein is in inclusion bodies

  • Intermediate purification:

    • Ion exchange chromatography based on predicted isoelectric point

    • Hydrophobic interaction chromatography as an alternative

  • Polishing step:

    • Size exclusion chromatography to remove aggregates and achieve >95% purity

    • Buffer optimization for downstream applications (structural studies)

  • Quality control:

    • SDS-PAGE with silver staining to assess purity

    • Western blotting with anti-His antibodies to confirm identity

    • Mass spectrometry for final verification

How can I design a randomized complete block design (RCBD) experiment to study the effects of crcB1 on bacterial fluoride resistance?

The RCBD approach is ideal for controlling experimental variability when testing crcB1 function :

  • Treatment groups:

    • Wild-type P. acnes

    • crcB1 knockout strain

    • Complemented crcB1 knockout

    • Positive control (known fluoride-resistant strain)

  • Blocking factors (sources of variation to control):

    • Different fluoride concentrations (e.g., 0, 50, 100, 250 μM)

    • Growth media types

    • Anaerobic vs. aerotolerant conditions

  • Experimental design table:

Block (Fluoride μM)Rep 1Rep 2Rep 3
0ACB
50BAD
100CDA
250DBC

Where A=Wild-type, B=crcB1 knockout, C=Complemented strain, D=Positive control

  • Analysis approach:

    • Two-way ANOVA to assess main effects and interactions

    • Calculate relative growth inhibition percentages

    • Use post-hoc tests (e.g., Tukey's HSD) to determine significant differences between treatments

Remember that the RCBD increases precision by grouping experimental units into blocks where conditions are as uniform as possible, allowing observed differences between treatments to be largely attributed to true differences rather than experimental variation .

What controls should be included when studying the influence of crcB1 on P. acnes physiology?

Comprehensive controls are essential for accurate interpretation:

  • Genetic controls:

    • Wild-type P. acnes (positive control)

    • crcB1 knockout strain

    • Complemented knockout strain (restoration of phenotype)

    • Empty vector control (for complementation)

  • Experimental controls:

    • Growth media without the stress condition being tested

    • Parallel experiments with known fluoride channel blockers

    • Inclusion of E. coli ΔcrcB strain as a reference point

  • Technical controls:

    • Multiple biological replicates (minimum n=3)

    • Technical replicates within each biological replicate

    • Measurement of growth parameters at multiple timepoints

What transcriptomic approaches can reveal the regulatory networks associated with crcB1 expression in P. acnes?

Similar to approaches used for studying CREB1 target genes in other systems :

  • RNA-Seq experimental design:

    • Compare wild-type, crcB1 knockout, and overexpression strains

    • Include multiple timepoints after fluoride exposure

    • Consider different physiological conditions (pH, growth phase)

  • Analytical pipeline:

    • Quality control and normalization of sequencing data

    • Differential expression analysis using DESeq2 or edgeR

    • Gene set enrichment analysis (GSEA) to identify pathways

  • Validation strategies:

    • RT-qPCR for key differentially expressed genes

    • Protein expression confirmation via western blot

    • Functional validation of key predictions through knockout studies

  • Network analysis:

    • Construction of gene co-expression networks

    • Identification of transcription factor binding motifs

    • Integration with existing P. acnes genomic databases

How can I apply community-based participatory research (CBPR) principles to study the role of crcB1 in P. acnes virulence in clinical isolates?

While CBPR is typically applied to public health research, its principles can be adapted for clinical microbiological research :

  • Partnership formation:

    • Establish collaborations between basic researchers, clinicians, and patient advocacy groups

    • Include dermatologists who regularly treat acne patients

    • Engage microbiologists specializing in skin microbiome

  • Study design development:

    • Co-create research questions addressing clinically relevant aspects of P. acnes virulence

    • Design sample collection protocols that respect patient concerns

    • Establish ethical frameworks for handling clinical isolates

  • Implementation approach:

    • Train clinical partners in standardized sampling techniques

    • Develop clear communication channels for sharing preliminary results

    • Create accessible databases of strain characteristics

  • Analysis and dissemination:

    • Involve all stakeholders in data interpretation

    • Co-author publications with clinical partners

    • Develop practical applications of findings for clinical practice

This approach ensures research addresses real clinical needs while maintaining scientific rigor in studying crcB1's potential role in virulence.

What are the challenges in culturing P. acnes for functional studies of crcB1, and how can they be overcome?

P. acnes presents several cultivation challenges that must be addressed for reliable functional studies :

  • Anaerobic growth requirements:

    • Use anaerobic chambers or anaerobic jars with gas-generating packs

    • Consider microaerophilic conditions (5-10% CO2, reduced O2) as an alternative

    • Pre-reduce media before inoculation

  • Slow growth characteristics:

    • Extend incubation periods to 5-7 days due to P. acnes' long generation time (~5.1 hours)

    • Monitor growth curves using OD600 readings at 24-hour intervals

    • Establish growth benchmarks specific to your strain and conditions

  • Media optimization:

    • Nutrient agar or broth is generally sufficient

    • For enhanced growth, consider supplementation with 5% sheep blood

    • Adjust pH to 6.0-7.0 for optimal growth

  • Contamination prevention:

    • Use selective media containing antibiotics that P. acnes is naturally resistant to

    • Perform regular Gram staining and morphological checks

    • Implement molecular verification (16S rRNA sequencing)

How should I analyze conflicting data regarding crcB1 function between different P. acnes phylotypes?

P. acnes strains show significant phylotype-specific differences in virulence factor expression , which may extend to crcB1:

  • Phylotype verification:

    • Confirm strain phylotypes (IA1, IA2, IB, II, III) using recA and tly gene sequencing

    • Document the specific strain designations used in all experiments

    • Include ATCC reference strains as standards (e.g., ATCC 6919)

  • Expression comparison approach:

    • Quantify crcB1 expression levels across phylotypes using RT-qPCR

    • Perform western blotting with specific antibodies to detect protein levels

    • Consider proteomic analysis for comprehensive protein expression profiles

  • Functional comparison framework:

    • Design parallel experiments testing the same parameters across phylotypes

    • Implement standardized protocols to minimize technical variation

    • Analyze data using two-way ANOVA with phylotype as a factor

  • Data interpretation strategies:

    • Contextual analysis considering the ecological niche of each phylotype

    • Correlation with other known phylotype-specific differences

    • Consider horizontal gene transfer and evolutionary relationships

  • Resolution tables: Create comparison tables documenting differences in:

PhylotypecrcB1 Expression LevelFluoride ResistanceAssociated Clinical Presentation
IA1[Data][Data][Data]
IB[Data][Data][Data]
II[Data][Data][Data]

This methodical approach will help resolve apparent contradictions in experimental results among different P. acnes phylotypes.

How can structural biology approaches advance our understanding of crcB1 function in P. acnes?

Several structural biology techniques can provide critical insights:

  • X-ray crystallography workflow:

    • Express and purify crcB1 to >95% purity

    • Screen multiple crystallization conditions (sparse matrix approach)

    • Optimize promising conditions for diffraction-quality crystals

    • Solve structure using molecular replacement or experimental phasing

  • Cryo-EM approach:

    • Particularly valuable if crcB1 forms multimeric complexes

    • Optimize sample preparation with different detergents

    • Collect data at multiple resolutions

    • Perform single-particle analysis and 3D reconstruction

  • Structure-function analysis:

    • Identify potential ion channel domains

    • Model ion coordination sites

    • Design site-directed mutagenesis experiments based on structural predictions

    • Correlate structural features with functional data

  • Comparative structural analysis:

    • Compare with known fluoride channel structures

    • Identify conserved and divergent features across bacterial species

    • Model evolutionary conservation patterns on structural framework

What research questions remain unanswered regarding the relationship between crcB1 and P. acnes pathogenicity?

Several critical questions warrant further investigation:

  • Expression correlation:

    • Is crcB1 expression upregulated during acne lesion formation?

    • Does crcB1 expression correlate with other virulence factors like CAMP1?

    • Is there differential expression between commensal and pathogenic strains?

  • Host-pathogen interactions:

    • Does crcB1 play a role in evading host immune responses?

    • Could crcB1 be a target for host antimicrobial peptides?

    • Does crcB1 contribute to biofilm formation in follicular environments?

  • Therapeutic implications:

    • Could crcB1 inhibitors serve as novel anti-acne treatments?

    • Is there synergy between fluoride and traditional acne treatments?

    • Does crcB1 contribute to antibiotic resistance mechanisms?

  • Evolutionary considerations:

    • Why have multiple crcB homologs been maintained in P. acnes genomes?

    • Is there evidence of horizontal gene transfer of crcB genes?

    • How do crcB variants correlate with P. acnes phylotypes associated with health versus disease?

Answering these questions will provide a more comprehensive understanding of crcB1's role in P. acnes biology and potentially open new therapeutic avenues for acne treatment.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.