Recombinant Propionibacterium acnes Protein CrcB homolog 2 (crcB2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference for your application.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
crcB2; PPA0771; Putative fluoride ion transporter CrcB 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-123
Protein Length
full length protein
Species
Propionibacterium acnes (strain KPA171202 / DSM 16379)
Target Names
crcB2
Target Protein Sequence
MTMLWVCLAGGLGAVARFLLDSRINSRFSVPVPLGTLVINVMGSLLLGLITAAALNHLGF SQNLKEPLGTGFCGGFTTFSTASVETARAAYGCGRRVGALHCMGMAIAGVLAAILGLALG SRV
Uniprot No.

Target Background

Function

Important Function: Reduces intracellular fluoride concentration, mitigating its toxicity.

Database Links

KEGG: pac:PPA0771

STRING: 267747.PPA0771

Protein Families
CrcB (TC 9.B.71) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Propionibacterium acnes CrcB homolog 2 and its basic molecular characteristics?

CrcB homolog 2 (crcB2) is a protein expressed by Propionibacterium acnes (P. acnes), an anaerobic bacterium that dominates the human skin microbiota, particularly in pilosebaceous units. While specific information about crcB2 is limited in current literature, P. acnes is known to express numerous proteins that contribute to its survival on human skin and potential pathogenicity . The protein belongs to the CrcB protein family, which in many bacterial species is involved in ion transport, particularly fluoride ion channels, suggesting a potential role in maintaining ion homeostasis within the bacterium.

CrcB homolog proteins typically have multiple transmembrane domains and function in bacterial cell membranes. Based on homology with similar proteins in related bacterial species, the molecular weight of recombinant P. acnes crcB2 with fusion tags is approximately 32 kDa, similar to other P. acnes secretory proteins such as CAMP factor .

How does CrcB homolog 2 fit within the broader context of P. acnes research?

CrcB homolog 2 represents one of many proteins encoded by P. acnes that potentially contribute to its interaction with the human host. P. acnes research has evolved significantly over the past decade, revealing extensive taxonomic and intraspecies diversity with particular strains associated with skin health and others with disease . The bacterium's genome includes numerous genes encoding proteins involved in degrading host molecules, which may contribute to its pathogenic potential .

Understanding specific proteins like crcB2 is crucial as research shifts toward strain-specific approaches to P. acnes management. Given that P. acnes is strongly associated with acne vulgaris while also playing beneficial roles in skin health, protein-specific research allows for targeted therapeutic approaches that could disrupt pathogenic functions while preserving commensal benefits .

What experimental approaches are recommended for initial characterization of recombinant CrcB homolog 2?

Initial characterization of recombinant CrcB homolog 2 should follow established protein characterization protocols:

  • Expression and Purification Validation:

    • SDS-PAGE analysis to confirm molecular weight

    • Western blotting with anti-His antibodies (for His-tagged recombinant proteins)

    • Mass spectrometry for peptide sequence confirmation, as demonstrated with other P. acnes proteins

  • Structural Analysis:

    • Circular dichroism spectroscopy to determine secondary structure

    • X-ray crystallography or cryo-EM for tertiary structure, if applicable

    • Membrane topology analysis for transmembrane domain identification

  • Functional Assessment:

    • Ion transport assays if involved in ion homeostasis

    • Protein-protein interaction studies to identify binding partners

    • Cell culture assays to assess effects on host cells

For example, similar approaches have been successfully used with P. acnes CAMP factor, where recombinant protein was expressed in E. coli, purified using a TALON resin column, and validated through NanoLC-LTQ MS/MS mass spectrometry .

What are the optimal expression systems for producing functional recombinant CrcB homolog 2?

The optimal expression system for producing functional recombinant CrcB homolog 2 depends on research objectives and protein characteristics. Based on successful approaches with other P. acnes proteins:

E. coli Expression Systems:

  • BL21(DE3) strain with pET expression vectors has been successfully used for other P. acnes proteins

  • IPTG induction typically at 0.5-1 mM concentration

  • Expression at lower temperatures (16-25°C) may improve protein solubility

  • For membrane proteins like CrcB, specialized E. coli strains such as C41(DE3) or C43(DE3) may be beneficial

Alternative Expression Systems:

  • Yeast systems (Pichia pastoris) for proteins requiring eukaryotic post-translational modifications

  • Cell-free expression systems for potentially toxic membrane proteins

  • Mammalian expression systems for functional studies requiring appropriate glycosylation

The choice should be guided by protein solubility analysis. For instance, with P. acnes CAMP factor, expression in E. coli resulted in the protein being found primarily in the insoluble fraction, necessitating appropriate solubilization and refolding strategies .

What purification challenges are commonly encountered with CrcB homolog 2 and how can they be addressed?

Purification of membrane-associated or transmembrane proteins like CrcB homolog 2 presents several challenges:

Common Challenges and Solutions:

  • Protein Solubility:

    • Challenge: Membrane proteins often form inclusion bodies

    • Solution: Use mild detergents (DDM, LDAO, or CHAPS) for solubilization

    • Alternative: Denaturing purification followed by controlled refolding

  • Maintaining Native Conformation:

    • Challenge: Preserving functional structure during extraction

    • Solution: Optimize detergent concentration and buffer conditions

    • Method: Use size exclusion chromatography to confirm monodispersity

  • Purification Strategy:

    • Primary method: Immobilized metal affinity chromatography (IMAC) with TALON or Ni-NTA resins for His-tagged proteins

    • Secondary purification: Ion exchange chromatography

    • Final polishing: Size exclusion chromatography

  • Protein Stability:

    • Challenge: Maintaining stability during storage

    • Solution: Test various buffer compositions and cryoprotectants

    • Approach: Assess stability through activity assays at different timepoints

For P. acnes proteins, researchers have successfully used TALON resin columns for purification of recombinant proteins expressed with 6×His fusion tags , which could be applied to crcB2 purification with appropriate modifications for membrane protein characteristics.

What are the recommended methods for assessing the functional activity of CrcB homolog 2?

Assessing functional activity of CrcB homolog 2 requires methods specific to its predicted functions:

Ion Transport Function Assessment:

  • Liposome reconstitution assays with fluorescent ion indicators

  • Patch-clamp electrophysiology for direct measurement of ion currents

  • Ion flux assays using radioisotope-labeled ions

Protein-Protein Interaction Studies:

  • Pull-down assays to identify binding partners

  • Surface plasmon resonance (SPR) for binding kinetics

  • Yeast two-hybrid or bacterial two-hybrid screening

Cellular Function Assessment:

  • Bacterial complementation studies in CrcB-deficient strains

  • Fluoride or other ion sensitivity assays in expression systems

  • Membrane potential measurements in bacterial cells

Structural Analysis Methods:

  • Hydrogen-deuterium exchange mass spectrometry for conformational changes

  • Cryo-EM for structural determination in different functional states

  • Molecular dynamics simulations based on structural data

For context, functional studies of other P. acnes proteins, such as CAMP factor, have utilized co-hemolytic activity assays and cell culture models to assess cytotoxicity to keratinocytes and macrophages .

How does the structure-function relationship of CrcB homolog 2 compare with other bacterial ion transporters?

The structure-function relationship of CrcB homolog 2 can be analyzed in comparison to other bacterial ion transporters through multiple approaches:

Comparative Structural Analysis:

FeatureCrcB Family ProteinsOther Bacterial Ion TransportersPotential Significance
Transmembrane domainsTypically 7-10Variable (4-12)Determines ion pathway geometry
Selectivity filterConserved regionsDiverse mechanismsDefines ion specificity
Oligomerization stateHomodimeric (predicted)Monomeric to tetramericAffects transport capability
Regulatory domainsLimited cytoplasmic regionsOften extensiveMay impact response to cellular signals

Evolutionary Context:
Phylogenetic analysis of CrcB proteins across bacterial species suggests that these transporters are ancient and highly conserved, indicating their fundamental importance for bacterial survival. The presence of multiple CrcB homologs in P. acnes suggests potential functional diversification within this bacterial species .

To comprehensively address this question, researchers should combine structural biology techniques, functional assays, and computational approaches including homology modeling and molecular dynamics simulations.

What is the potential role of CrcB homolog 2 in P. acnes virulence and pathogenicity?

While direct evidence for CrcB homolog 2's role in P. acnes pathogenicity is not fully established, we can propose mechanisms based on our understanding of both ion transport proteins and P. acnes virulence factors:

Potential Pathogenic Mechanisms:

  • Microenvironmental Adaptation:

    • Ion transporters often contribute to bacterial adaptation to changing host environments

    • May help P. acnes survive acidic conditions within sebaceous follicles

    • Could contribute to persistence during inflammatory responses

  • Interaction with Host Defense Mechanisms:

    • Ion homeostasis proteins can protect bacteria against antimicrobial peptides

    • May contribute to resistance against host-produced reactive oxygen species

    • Could play a role in biofilm formation, which is associated with P. acnes persistence

  • Comparative Analysis with Known Virulence Factors:
    P. acnes produces several established virulence factors, including CAMP factors that interact with host acid sphingomyelinase to amplify bacterial virulence . While CrcB is structurally dissimilar to CAMP factors, it may contribute to pathogenicity through different mechanisms.

  • Strain-Specific Expression:
    Evidence suggests that P. acnes virulence varies by phylotype, with type IA1 strains most strongly associated with acne vulgaris . Analysis of CrcB homolog 2 expression across different P. acnes strains could reveal correlations with virulence.

Studies of P. acnes pathogenicity have shown that it induces inflammatory responses through pattern recognition receptors like TLR2 and TLR4, activates the NLRP3-inflammasome, and stimulates production of IL-1β and IL-17 . Determining whether CrcB homolog 2 contributes to these processes would require specific gene knockout or protein inhibition studies.

How might CrcB homolog 2 interact with the host immune system during P. acnes colonization?

CrcB homolog 2, as a potential component of P. acnes' interaction with host physiology, may influence immune responses through several mechanisms:

Potential Immune Interactions:

  • Antigen Presentation and Recognition:

    • Bacterial membrane proteins can be recognized by pattern recognition receptors

    • May potentially activate TLR signaling pathways similar to other P. acnes components

    • Could be recognized as a foreign antigen by adaptive immune cells

  • Indirect Immunomodulation:

    • By maintaining bacterial homeostasis, may indirectly affect production of immunomodulatory factors

    • Could influence P. acnes persistence, prolonging interaction with immune cells

    • May contribute to strain-specific differences in immunogenicity

  • Role in Inflammatory Cascades:
    P. acnes is known to trigger production of proinflammatory cytokines including IL-1β through the NLRP3 inflammasome pathway . While CrcB homolog 2 may not directly activate these pathways like CAMP factors do , it could contribute to bacterial fitness during infection, thereby affecting the duration and intensity of inflammatory responses.

  • Potential as an Immunotherapeutic Target:
    Research on P. acnes CAMP factors has demonstrated that vaccination against specific bacterial components can provide protective immunity against P. acnes-induced inflammation . Similar approaches targeting CrcB homolog 2 would require assessment of its surface exposure and immunogenicity.

Experimental approaches to address these questions would include co-culture of recombinant CrcB homolog 2 with human immune cells, assessment of cytokine responses, and in vivo studies comparing wild-type and CrcB homolog 2-deficient P. acnes strains.

How can researchers design experiments to determine the localization and expression patterns of CrcB homolog 2 across different P. acnes strains?

Designing experiments to determine localization and expression patterns of CrcB homolog 2 requires a multi-faceted approach:

Strain Selection Strategy:
Include representatives from major P. acnes phylogroups, particularly:

  • Type IA1 strains (strongly associated with acne)

  • Type IA2, IB, II, and III strains (more associated with healthy skin)

  • Clinical isolates from both acneic and healthy skin

Expression Analysis Methods:

  • Transcriptomic Approaches:

    • RT-qPCR to quantify crcB2 transcript levels across strains

    • RNA-Seq for genome-wide expression context

    • Single-cell RNA-Seq for expression heterogeneity within populations

  • Protein Level Detection:

    • Generation of specific antibodies against CrcB homolog 2

    • Western blotting of membrane fractions from different strains

    • Mass spectrometry-based proteomics for absolute quantification

  • Subcellular Localization:

    • Immunofluorescence microscopy with anti-CrcB antibodies

    • Electron microscopy with immunogold labeling

    • Fractionation studies to confirm membrane association

  • Expression Conditions:
    Test expression under various relevant conditions:

    • Different growth phases

    • Varying pH conditions mimicking skin microenvironments

    • Co-culture with host cells

    • Biofilm versus planktonic growth states

This approach would create a comprehensive map of CrcB homolog 2 expression patterns across the P. acnes phylogenetic spectrum, potentially revealing correlations with strain virulence or commensalism patterns similar to those observed for other P. acnes components .

What knockout or knockdown strategies would be most effective for studying the function of CrcB homolog 2 in P. acnes?

Genetic Manipulation Approaches:

  • CRISPR-Cas9 System Adaptation:

    • Design sgRNAs targeting crcB2 gene

    • Optimize transformation protocols for P. acnes

    • Use either knockout (gene disruption) or CRISPRi (for knockdown)

    • Challenge: Efficient delivery into P. acnes cells

  • Homologous Recombination Strategies:

    • Create targeting constructs with antibiotic resistance markers

    • Use electroporation or conjugation for DNA delivery

    • Screen for successful recombination events

    • Consider counterselection methods for marker removal

  • Antisense RNA Approaches:

    • Design antisense oligonucleotides targeting crcB2 mRNA

    • Optimize delivery into P. acnes cells

    • Validate knockdown efficiency by RT-qPCR and Western blot

    • Limited duration of effect compared to genetic approaches

  • Heterologous Expression Systems:

    • Express crcB2 in more genetically tractable bacteria

    • Create chimeric proteins for functional assessment

    • Complement crcB mutants in model organisms

Phenotypic Assessment of Mutants:
After successful generation of knockouts or knockdowns, assess:

  • Growth characteristics under various conditions

  • Ion sensitivity, particularly to fluoride

  • Interaction with host cells

  • Virulence in appropriate model systems

  • Membrane potential and ion homeostasis

This strategy follows the general approach used for functional characterization of other P. acnes components, such as CAMP factor, where manipulation of the bacterial factor combined with host factor inhibition provided insights into pathogenic mechanisms .

How can researchers design experiments to investigate the potential of CrcB homolog 2 as a therapeutic target for acne vulgaris?

Investigating CrcB homolog 2 as a therapeutic target requires a systematic approach from validation to therapeutic development:

Target Validation Strategy:

  • Expression Correlation Studies:

    • Compare crcB2 expression between acne-associated and commensal strains

    • Analyze expression in clinical samples from acne versus healthy skin

    • Correlate expression with disease severity metrics

  • Functional Necessity Assessment:

    • Generate crcB2 knockout strains as described in 4.2

    • Assess impact on P. acnes survival in skin-relevant conditions

    • Determine effects on virulence factor production

    • Evaluate contribution to biofilm formation

  • Host-Pathogen Interaction Studies:

    • Investigate if CrcB homolog 2 directly or indirectly affects host cell responses

    • Compare inflammatory responses to wild-type versus crcB2-deficient strains

    • Assess impact on P. acnes persistence in co-culture models

Therapeutic Development Approaches:

  • Small Molecule Inhibitor Screening:

    • Develop high-throughput assays for CrcB function

    • Screen chemical libraries for potential inhibitors

    • Assess specificity, potency, and toxicity

    • Optimize lead compounds for skin penetration

  • Immunotherapeutic Potential:

    • Evaluate immunogenicity of recombinant CrcB homolog 2

    • Test protective effects of anti-CrcB antibodies

    • Develop vaccination strategies similar to those explored for CAMP factor

    • Assess both preventive and therapeutic vaccination protocols

  • Combination Approaches:

    • Test synergy with established acne treatments

    • Investigate dual targeting of bacterial factors and host responses

    • Consider combination with ASMase inhibitors if mechanisms overlap with CAMP factors

  • Delivery System Development:

    • Design topical formulations for optimal skin penetration

    • Consider microparticle or liposomal delivery systems

    • Develop sustained-release mechanisms for prolonged effect

This approach builds on successful strategies used for other P. acnes virulence factors, such as CAMP factor, where vaccination provided protective immunity against P. acnes-induced inflammation in animal models .

How might multi-omics approaches advance our understanding of CrcB homolog 2 in the context of the skin microbiome?

Multi-omics approaches offer powerful tools for understanding CrcB homolog 2 in the broader context of skin microbiome interactions:

Integrated Multi-omics Strategy:

  • Metagenomics:

    • Analyze crcB2 gene prevalence across skin microbiome samples

    • Compare genetic variants between healthy and diseased skin

    • Assess genetic neighborhoods and potential horizontal gene transfer

  • Metatranscriptomics:

    • Measure in situ expression of crcB2

    • Compare expression levels between different skin sites and conditions

    • Identify co-expressed genes suggesting functional relationships

  • Metaproteomics:

    • Detect and quantify CrcB homolog 2 protein in skin samples

    • Map post-translational modifications

    • Identify protein interaction networks

  • Metabolomics:

    • Correlate CrcB homolog 2 expression with metabolite profiles

    • Identify potential substrates or effectors

    • Assess impact on host-microbe metabolic interactions

Integration and Modeling:

  • Develop computational models integrating multi-omics data

  • Apply machine learning to identify patterns associated with disease states

  • Create predictive models for therapeutic response

This approach would build upon existing studies that have used 16S rDNA metagenomic analysis to characterize P. acnes strain populations in acneic versus healthy skin , extending this to include functional information about specific components like CrcB homolog 2.

What are the potential applications of structural biology techniques in developing inhibitors targeting CrcB homolog 2?

Structural biology techniques offer critical insights for rational inhibitor design targeting CrcB homolog 2:

Structural Characterization Approaches:

  • X-ray Crystallography:

    • Determine high-resolution structure of CrcB homolog 2

    • Identify potential binding pockets for inhibitors

    • Co-crystallize with substrates or initial inhibitors

    • Challenge: Membrane protein crystallization difficulties

  • Cryo-Electron Microscopy:

    • Visualize CrcB homolog 2 in different conformational states

    • Determine oligomerization state in membrane environment

    • Advantage: Better preservation of native state

    • Challenge: Achieving sufficient resolution for atomic details

  • NMR Spectroscopy:

    • Characterize dynamics and conformational changes

    • Identify ligand binding sites through chemical shift perturbations

    • Challenge: Size limitations for membrane proteins

  • Computational Approaches:

    • Homology modeling based on related structures

    • Molecular dynamics simulations of ion transport

    • Virtual screening for potential inhibitors

    • In silico mutagenesis to predict functional residues

Structure-Based Drug Design Strategy:

  • Target Site Identification:

    • Ion conduction pathway

    • Allosteric regulatory sites

    • Protein-protein interaction interfaces

  • Rational Design Process:

    • Fragment-based approaches starting with small binders

    • Structure-activity relationship studies

    • Optimization for membrane penetration

    • Development of transition-state analogs if enzymatic function is present

  • Special Considerations for Membrane Proteins:

    • Design of compounds that can access transmembrane regions

    • Consideration of lipid interactions

    • Assessment of impacts on membrane integrity

This approach has been successfully applied to other bacterial membrane proteins and could yield selective inhibitors targeting CrcB homolog 2 with minimal effects on human proteins.

How might systems biology approaches help elucidate the role of CrcB homolog 2 in P. acnes adaptation to the skin microenvironment?

Systems-Level Analysis Approaches:

  • Network Analysis:

    • Construct gene regulatory networks including crcB2

    • Identify hub genes and potential master regulators

    • Map protein-protein interaction networks

    • Integrate with host response networks

  • Flux Balance Analysis:

    • Develop metabolic models incorporating ion transport functions

    • Predict metabolic shifts under different environmental conditions

    • Simulate effects of crcB2 inhibition on bacterial fitness

  • Host-Microbe Interaction Modeling:

    • Create agent-based models of P. acnes within follicular environments

    • Simulate emergent properties of polymicrobial communities

    • Model spatial dynamics of colonization and biofilm formation

Environmental Adaptation Studies:

  • Response to Changing Conditions:

    • pH fluctuations commonly found in skin microenvironments

    • Oxygen tension variations within follicles

    • Nutrient limitation scenarios

    • Host antimicrobial peptide exposure

  • Comparative Strain Analysis:

    • Systems-level comparison of acne-associated versus commensal strains

    • Identification of CrcB homolog 2 regulation differences between phylogroups

    • Correlation with other virulence factors like CAMP factors

These approaches would complement the finding that acne is associated with specific P. acnes phylogroups, particularly type IA1 and IC clades , by providing mechanistic insights into how specific components like CrcB homolog 2 contribute to these strain-specific differences in virulence or commensalism.

What are the most promising research directions for understanding CrcB homolog 2 function in P. acnes?

Based on current knowledge and technological capabilities, the most promising research directions include:

  • Structural and Functional Characterization:

    • Determining the three-dimensional structure of CrcB homolog 2

    • Confirming its ion transport specificity and kinetics

    • Elucidating regulatory mechanisms controlling its expression and activity

  • Strain-Specific Analysis:

    • Comparing crcB2 sequence variants across P. acnes phylogroups

    • Correlating expression levels with strain virulence potential

    • Determining if crcB2 contributes to the association of type IA1 strains with acne vulgaris

  • Host-Microbe Interaction Studies:

    • Investigating whether CrcB homolog 2 affects host cell responses

    • Determining its role in bacterial persistence during inflammation

    • Assessing potential interactions with host defense mechanisms

  • Therapeutic Development Pathways:

    • Evaluating CrcB homolog 2 as a target for small molecule inhibitors

    • Assessing its potential as a vaccine antigen

    • Developing combination approaches targeting multiple P. acnes virulence mechanisms

These directions align with the broader shift in P. acnes research toward understanding strain-specific virulence factors and developing targeted approaches that preserve beneficial commensal functions while disrupting pathogenic capabilities .

How does current knowledge about CrcB homolog 2 inform our broader understanding of P. acnes biology and acne pathogenesis?

While specific information about CrcB homolog 2 is still emerging, current understanding provides context for broader P. acnes biology and acne pathogenesis:

  • Multi-Component Virulence Systems:
    Research on P. acnes virulence factors like CAMP factor has revealed complex interactions with host components such as acid sphingomyelinase . CrcB homolog 2, as a potential ion transport protein, may similarly participate in sophisticated host-microbe interaction networks.

  • Strain-Specific Virulence Potential:
    The association of specific P. acnes phylogroups (type IA1 and IC) with acne vulgaris suggests that strain-specific factors, potentially including CrcB homolog 2 variants, contribute to differential virulence.

  • Microenvironmental Adaptation:
    Ion transport proteins like CrcB homolog 2 likely contribute to P. acnes' ability to adapt to the unique microenvironments of sebaceous follicles, potentially explaining its dominance in these niches .

  • Potential Therapeutic Approaches:
    The success of experimental approaches targeting other P. acnes factors, such as CAMP factor vaccination , suggests similar strategies targeting CrcB homolog 2 might prove effective if this protein contributes significantly to virulence.

Understanding CrcB homolog 2 within this broader context may help resolve contradictions in acne research, such as why P. acnes abundance does not consistently correlate with acne severity , by highlighting the importance of strain-specific virulence factors and host-microbe interactions rather than simple bacterial abundance.

What methodological advances would most accelerate research on P. acnes CrcB homolog 2 and similar bacterial membrane proteins?

Several methodological advances would significantly accelerate research on P. acnes CrcB homolog 2:

  • Genetic Tools Development:

    • Improved transformation methods for P. acnes

    • Adaptation of CRISPR-Cas9 systems for efficient gene editing

    • Development of inducible expression systems

    • Creation of reporter constructs for in vivo studies

  • Structural Biology Innovations:

    • Advances in membrane protein crystallization techniques

    • Improved cryo-EM methodologies for smaller membrane proteins

    • Development of native mass spectrometry approaches for membrane complexes

    • Computational methods for accurate structure prediction from limited data

  • Single-Cell and In Situ Technologies:

    • Methods for studying gene expression in situ within follicular environments

    • Single-cell approaches for heterogeneity analysis in P. acnes populations

    • Advanced imaging techniques for visualizing host-microbe interactions

    • Microfluidic systems mimicking the follicular microenvironment

  • Translational Research Tools:

    • Improved ex vivo skin models incorporating microbiome components

    • Development of animal models better reflecting human acne pathogenesis

    • High-throughput screening platforms for membrane protein inhibitors

    • Biomarker discovery methods for monitoring therapeutic responses

These methodological advances would address current limitations in studying P. acnes membrane proteins and accelerate the development of targeted approaches for managing acne vulgaris while preserving beneficial functions of the skin microbiome .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.