Recombinant Propithecus coquereli Transmembrane O-methyltransferase (LRTOMT)

Shipped with Ice Packs
In Stock

Description

Introduction

LRTOMT (Leucine Rich Transmembrane and O-methyltransferase) is a gene that encodes a protein involved in various biological processes, including hearing and possibly other functions related to methyltransferase activity . LRTOMT exhibits transcription-mediated gene fusion and has dual reading frames . Initially identified as LRRC51, further research led to its renaming to LRTOMT .

Gene Location and Structure

The LRTOMT gene is located on human chromosome 11q13.3-q13.4 at the DFNB63 locus . This region spans approximately 1.03 Mb and contains 26 annotated and predicted genes . The gene comprises 10 exons that undergo alternative splicing, resulting in five different transcripts .

Mutations and Hearing Loss

Mutations in LRTOMT are associated with profound non-syndromic hearing loss . Several pathogenic mutations have been identified, including:

  • c.242G>A (p.R81Q)

  • c.313T>C (p.W105R)

  • c.328G>A (p.E110K)

These mutations are non-conservative amino acid substitutions predicted to alter catechol-O-methyltransferase activity . The absence of exon 8 in lymphoblastoid RNA transcripts of affected individuals leads to a frameshift and premature stop codon within the mRNA encoding LRTOMT2 (p.A29SfsX54) .

Protein Isoforms and Expression

LRTOMT encodes multiple protein isoforms, including LRTOMT1 and LRTOMT2 . The isoforms show varying expression patterns in different tissues.

  • LRTOMT1: Found in human liver, kidney, and spleen

  • LRTOMT2: A 38 kDa protein found in human liver and kidney, potentially corresponding to isoform D′ (32.2 kDa)

Western blot analyses have detected proteins of similar sizes in mouse cochlea, retina, and heart .

Functional Analysis

LRTOMT2 contains a catechol-O-methyltransferase domain, suggesting it functions as a methyltransferase . Molecular modeling, using rat COMT as a template, shows 39% sequence identity between the modeled region of LRTOMT2 (residues 79-290) and rat COMT .

Evolutionary Conservation

LRTOMT isoforms have been evaluated in various species, including chimpanzees, rhesus monkeys, baboons, and lemurs, using cDNA prepared from brain tissue . This indicates evolutionary conservation and potential functional importance across species.

Role in Termites

Metatranscriptomic analysis of the termite Reticulitermes flavipes revealed bacterial contributions to the holobiont, including biosynthesis, catabolism, and transport of major organic molecules and ions . Bacteria also play roles in nitrogen fixation, amino acid biosynthesis, and lignocellulose digestion .

Bergaptol O-Methyltransferase from Peucedanum praeruptorum

A Bergaptol O-methyltransferase (BMT) cDNA was cloned and characterized from Peucedanum praeruptorum . The recombinant protein showed activity toward bergaptol with narrow substrate specificity . Expression analysis indicated higher expression in roots, inducible by methyl jasmonate, and subcellular localization in the cytoplasm . Homology modeling and site-directed mutagenesis identified key amino acid residues for substrate binding (F171, M175, D226, and L312) and catalysis (H264) .

O-Methyltransferases and Coumarin Biosynthesis

O-methyltransferases (OMTs) are involved in coumarin biosynthesis . The cloned PpBMT sequence shares high similarity with AmBMT and GlBMT, suggesting similar enzymatic functions . Conserved regions and residues are involved in SAM binding and substrate binding .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
TOMT; COMT2; LRTOMT; Transmembrane O-methyltransferase; Catechol O-methyltransferase 2; Protein LRTOMT2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-274
Protein Length
full length protein
Species
Propithecus coquereli (Coquerel's sifaka) (Propithecus verreauxi coquereli)
Target Names
LRTOMT
Target Protein Sequence
MGTPWRKRKGITQVGTMSPAIALAFLPLVVTLLVRYRHYFRLLVGTVLLRSLRDCLSGLR IEERAFSYVLTHALPGDPGHILTTLDHWSSHCEYLSHMGPVKGQILMRLVEEKAPACVLE LGTYCGYSTLLIAQALPPGGRLLTVERDPRTAAVAEKLIRLAGFDEHMVELIVGSSEEVI PCLRTQYQLSRADLVLLIHRPRCYLRDLQLLEAHALLPAGATVLADHVLFPGAPRFLQYA KSCGRYRCRLYHTGLPDFPAIKDGIAQLTYAGPG
Uniprot No.

Target Background

Function

Recombinant Propithecus coquereli Transmembrane O-methyltransferase (LRTOMT) catalyzes the O-methylation and subsequent inactivation of catecholamine neurotransmitters and catechol hormones. It is essential for auditory function, serving as a component of the cochlear hair cell's mechanotransduction (MET) machinery. Specifically, it participates in the assembly of the asymmetric tip-link MET complex and is required for the transport of TMC1 and TMC2 proteins into the mechanically sensitive stereocilia of hair cells. Importantly, its function in MET is independent of its enzymatic activity.

Protein Families
Class I-like SAM-binding methyltransferase superfamily, Cation-dependent O-methyltransferase family
Subcellular Location
[Isoform 1]: Membrane; Single-pass membrane protein.; [Isoform 2]: Cytoplasm. Endoplasmic reticulum.

Q&A

What is LRTOMT and what makes it structurally unique?

LRTOMT is a fusion gene with alternative reading frames that encodes two different proteins: LRTOMT1 and LRTOMT2. This gene represents an evolutionary novelty where two ancestral genes (Lrrc51 and Tomt) fused in the primate lineage but remain separate in rodents . The remarkable feature of LRTOMT is its ability to utilize dual reading frames, where certain exons (specifically exons 5, 7, and 8) can be translated in two different reading frames, encoding either the C-terminus of LRTOMT1 or the N-terminus of LRTOMT2 . LRTOMT1 contains leucine-rich repeats, while LRTOMT2 possesses a catechol-O-methyltransferase domain and potentially a transmembrane helix depending on alternative splicing .

How does LRTOMT function differ between species, particularly in Propithecus coquereli versus humans?

While the search results don't specifically detail functional differences in LRTOMT between Propithecus coquereli and humans, comparative analysis would likely focus on the conservation of key domains. In humans, mutations in LRTOMT are associated with profound non-syndromic hearing loss at the DFNB63 locus on chromosome 11q13.3-q13.4 . The catechol-O-methyltransferase domain of LRTOMT2 appears particularly important, with several pathogenic mutations identified in this region . For Propithecus coquereli, genomic databases indicate it possesses numerous protein-coding genes , but specific functional studies comparing LRTOMT activity between this lemur species and humans would require direct experimental investigation focusing on protein structure conservation and enzymatic activity.

What role does LRTOMT play in hearing mechanisms?

LRTOMT plays a critical role in normal auditory function, with mutations in this gene associated with profound non-syndromic hearing loss . The specific molecular mechanisms through which LRTOMT affects hearing remain under investigation, but the evidence suggests that the methyltransferase activity of LRTOMT2 is particularly important. The identified pathogenic mutations (p.R81Q, p.W105R, and p.E110K) affect the catechol-O-methyltransferase domain, specifically altering helix 1, helix 2, and the loop following helix 2 . These structural elements are crucial for protein stability and may indirectly affect the substrate-binding region . The precise substrates methylated by LRTOMT2 in the auditory system and how this methylation impacts hearing remain active areas of research.

What are the optimal expression systems for producing recombinant Propithecus coquereli LRTOMT?

For recombinant expression of Propithecus coquereli LRTOMT, researchers should consider multiple expression systems based on the intended experimental applications. Bacterial expression systems (E. coli) offer cost-effectiveness and high protein yields but may struggle with proper folding of complex mammalian proteins with post-translational modifications. For functional studies requiring proper protein folding and post-translational modifications, mammalian expression systems (HEK293 or CHO cells) would be more appropriate despite lower yields.

When designing expression constructs, special attention must be paid to the dual reading frame nature of LRTOMT . Depending on the research question, constructs should be designed to express either LRTOMT1, LRTOMT2, or both. For LRTOMT2 expression, initiating translation from exon 5 would be crucial . Codon optimization for the chosen expression system should be considered while preserving the critical structural elements identified in the catechol-O-methyltransferase domain, particularly around residues R81, W105, and E110 which have been implicated in pathogenic mutations .

How should researchers approach protein purification for recombinant LRTOMT?

Purification of recombinant LRTOMT presents challenges due to its potential transmembrane domain and complex structure. A multi-step purification strategy is recommended:

  • Initial capture using affinity chromatography with a fusion tag (His-tag or GST-tag)

  • Intermediate purification via ion exchange chromatography based on the protein's theoretical isoelectric point

  • Final polishing with size exclusion chromatography to ensure homogeneity

For LRTOMT2 variants that include the transmembrane domain, detergent solubilization would be necessary. Mild detergents like DDM (n-Dodecyl β-D-maltoside) or LMNG (Lauryl Maltose Neopentyl Glycol) are recommended to maintain protein structure and function. If studying the enzymatic activity, researchers should verify that the purified protein retains its methyltransferase function through activity assays before proceeding to structural or functional studies.

What controls are essential when studying LRTOMT mutations in experimental models?

When investigating LRTOMT mutations, particularly those associated with hearing loss (p.R81Q, p.W105R, and p.E110K) , several controls are essential:

  • Wild-type LRTOMT as a positive control for normal function

  • A catalytically dead mutant (mutation in the methyltransferase active site) as a negative control

  • Species-matched controls when comparing between human and Propithecus coquereli LRTOMT

  • Tissue/cell-type appropriate expression controls, particularly for auditory tissue models

For RNA-based studies, controls should include verification of splice variants, as demonstrated by the RT-PCR analysis that revealed exon 8 absence in lymphoblastoid RNA transcripts of affected individuals . This is critical since alternative splicing can significantly alter protein function, especially given that exon 8 contains an alternative acceptor splice site that determines whether LRTOMT2 includes a predicted transmembrane helix .

How can structural modeling help predict the impact of novel LRTOMT mutations?

Structural modeling provides valuable insights into the functional consequences of LRTOMT mutations. As demonstrated with known pathogenic mutations (p.R81Q, p.W105R, and p.E110K), in silico modeling can predict how mutations affect protein stability and function . For novel mutations, researchers should:

  • Generate homology models based on known methyltransferase structures

  • Analyze the location of mutations relative to functional domains

  • Simulate the effects of mutations on protein folding and stability using molecular dynamics

  • Assess potential disruptions to substrate binding or catalytic activity

The published research on LRTOMT demonstrates the utility of this approach, showing that p.R81 and p.E110 form a salt bridge and hydrogen bonds between helix 1 and a loop, while p.W105 makes hydrophobic interactions in the core between helices . These structural elements are critical for protein stability and can indirectly affect substrate binding . For any novel mutations, similar analytical approaches can help prioritize variants for functional validation.

What are the approaches for investigating the evolutionary significance of the LRTOMT gene fusion?

Investigating the evolutionary significance of the LRTOMT gene fusion requires a comprehensive comparative genomics approach:

  • Sequence comparison across diverse primate and non-primate species to establish the timing of the fusion event

  • Functional comparison of the fused LRTOMT in primates versus the separate Lrrc51 and Tomt in rodents

  • Analysis of selection pressures on the fusion gene compared to the ancestral separate genes

  • Investigation of tissue expression patterns to identify potential novel functions acquired after fusion

This evolutionary analysis can provide insights into why gene fusion events are maintained in certain lineages. The LRTOMT case is particularly interesting as it represents an example of dual reading frame usage, a phenomenon predicted to occur in approximately 7% of alternatively spliced human genes but with few well-studied examples . Comparing the Propithecus coquereli LRTOMT with human and other primate versions could reveal lineage-specific adaptations in this fusion gene.

How can CRISPR-Cas9 genome editing be optimized for studying LRTOMT function?

CRISPR-Cas9 genome editing offers powerful approaches for studying LRTOMT function in cellular and animal models:

Special consideration should be given to the dual reading frame nature of LRTOMT when designing editing strategies . Mutations intended to affect one reading frame might inadvertently impact the other. Additionally, when working with Propithecus coquereli models or cell lines, species-specific optimization of CRISPR components may be necessary to ensure efficient editing.

What are common challenges in recombinant LRTOMT activity assays and how can they be addressed?

Methyltransferase activity assays for recombinant LRTOMT face several technical challenges:

  • Substrate uncertainty: The natural substrates for LRTOMT2 in the auditory system remain incompletely characterized. Researchers should test multiple potential substrates including catechol compounds.

  • Assay sensitivity: Methyltransferase assays often require detection of small amounts of methylated product. Radiolabeled S-adenosyl methionine (SAM) or sensitive LC-MS/MS methods are recommended.

  • Isoform complexity: The dual reading frame nature of LRTOMT means careful isoform characterization is necessary before activity assessment.

  • Protein stability: The identified mutations affecting protein stability suggest wild-type LRTOMT may also have stability issues. Optimize buffer conditions (pH, salt, reducing agents) to maintain activity.

Control experiments should include heat-inactivated enzyme, known methyltransferase inhibitors, and comparison with other characterized methyltransferases. For variants with the transmembrane domain, detergent choice can significantly impact activity measurements.

How should researchers interpret conflicting data between in vitro and in vivo LRTOMT studies?

When facing discrepancies between in vitro and in vivo LRTOMT studies, researchers should consider:

  • Contextual differences: The cellular environment provides cofactors, interacting proteins, and appropriate subcellular localization that may be absent in vitro

  • Post-translational modifications: In vivo systems may provide essential modifications missing from recombinant systems

  • Isoform expression: Different splice variants predominate in different tissues or developmental stages

  • Species differences: Functional divergence between human and Propithecus coquereli LRTOMT might explain some discrepancies

Resolving such conflicts typically requires multiple complementary approaches, including:

  • Cell-based assays with endogenous or controlled expression levels

  • Tissue-specific analyses that match the biological context of interest (e.g., auditory tissues)

  • Biochemical validation using purified components from the relevant species

  • Careful interpretation of mutations in structural contexts as demonstrated for the p.R81Q, p.W105R, and p.E110K mutations

What statistical approaches are most appropriate for analyzing LRTOMT mutation effects across populations?

When analyzing LRTOMT mutation effects across populations, researchers should employ:

  • Case-control association studies with proper matching for genetic background

  • Family-based association tests for hearing loss phenotypes, similar to the approaches used to identify pathogenic LRTOMT mutations

  • Variant frequency analysis comparing disease and control populations

  • Meta-analysis when combining data from multiple studies or populations

Statistical power calculations should account for the rarity of specific mutations. For example, the mutations described in the research (c.242G>A, c.313T>C, c.328G>A) were identified in specific family groups. When analyzing sequence data, algorithms should be sensitive to the complex splicing patterns observed in LRTOMT, including the alternative acceptor splice site in exon 8 that affects the presence of the transmembrane domain .

What are promising approaches for developing LRTOMT-targeted therapeutics for hearing loss?

Research into LRTOMT-targeted therapeutics for hearing loss could explore several promising avenues:

  • Gene therapy approaches to deliver functional LRTOMT to the inner ear

  • Small molecule screening to identify compounds that could stabilize mutant LRTOMT2 proteins with stability defects

  • Substrate analog development to compensate for deficient methyltransferase activity

  • Exon skipping or splicing modification therapies for mutations affecting proper splicing

These approaches would require detailed understanding of the structure-function relationships in LRTOMT2, particularly how the identified mutations (p.R81Q, p.W105R, and p.E110K) affect protein stability and the salt bridge between helix 1 and the loop following helix 2 . Comparative studies between human and Propithecus coquereli LRTOMT might reveal natural variants with enhanced stability or activity that could inform therapeutic design.

How might comparative studies between primate and non-primate LRTOMT inform our understanding of hearing mechanisms?

Comparative studies between primate LRTOMT (fused gene) and non-primate Lrrc51/Tomt (separate genes) offer unique insights into hearing evolution:

  • Functional analysis comparing methyltransferase activity between fused and separate proteins

  • Expression pattern comparison in auditory tissues across species

  • Investigation of whether the gene fusion created novel protein interactions or regulatory mechanisms

  • Analysis of hearing sensitivity and frequency range in species with fused versus separate genes

This evolutionary perspective could reveal whether the LRTOMT fusion represents an adaptation for specific auditory functions in primates or serves other purposes. Propithecus coquereli, as a lemur species, occupies an interesting phylogenetic position for such comparative studies, potentially providing insights into the early stages of primate auditory evolution.

What role might LRTOMT play in other neurological processes beyond hearing?

While LRTOMT mutations are associated with non-syndromic hearing loss , its potential roles in other neurological processes deserve investigation:

  • Expression analysis across neural tissues beyond the auditory system

  • Investigation of methylated substrates in different neural compartments

  • Potential roles in neurodevelopment related to its methyltransferase activity

  • Interaction networks in various neural cell types

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.