Recombinant Propithecus diadema diadema NADH-ubiquinone oxidoreductase chain 4L (MT-ND4L)

Shipped with Ice Packs
In Stock

Description

Functional Role in Mitochondrial Complex I

MT-ND4L is a hydrophobic subunit of Complex I, a multi-subunit enzyme responsible for transferring electrons from NADH to ubiquinone. Its primary functions include:

  • Electron Transport: Facilitates the initial step of oxidative phosphorylation, generating a proton gradient across the mitochondrial inner membrane.

  • Proton Pumping: Contributes to ATP synthesis by exporting protons during electron transfer.

  • Structural Integrity: Forms part of the transmembrane domain critical for Complex I assembly and stability .

Mutations in human MT-ND4L (e.g., Val65Ala) are linked to Leber’s Hereditary Optic Neuropathy (LHON), a mitochondrial disorder causing vision loss. While the Propithecus variant has not been directly associated with disease, its study informs evolutionary and functional aspects of Complex I .

Research Applications

This recombinant protein enables diverse experimental approaches:

ApplicationDetails
Biochemical AssaysActivity measurements (e.g., NADH-ubiquinone reductase activity)
Structural StudiesX-ray crystallography or cryo-EM to resolve subunit arrangements in Complex I
Disease ModelingInvestigating species-specific Complex I dynamics and mitochondrial dysfunction
Therapeutic ResearchScreening small molecules targeting Complex I activity or stability

Note: His-tagged proteins are often used in affinity chromatography for purification .

Species-Specific Insights

The Propithecus diadema diadema MT-ND4L differs from human orthologs in sequence and potential regulatory elements. Key distinctions include:

  • Gene Overlap: Unlike human MT-ND4L (which overlaps with MT-ND4), the sifaka variant lacks such structural complexity, simplifying its transcriptional regulation .

  • Evolutionary Significance: Comparative studies may reveal adaptations in mitochondrial function across primates, particularly in energy-demanding tissues like brain or muscle .

Clinical and Diagnostic Relevance

While not directly linked to human disease, this protein serves as a tool for:

  • Complex I Dysfunction Studies: Elucidating subunit interactions in mitochondrial disorders.

  • Antibody Development: His-tagged MT-ND4L facilitates immunodetection (e.g., Western blotting) .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
MT-ND4L; MTND4L; NADH4L; ND4L; NADH-ubiquinone oxidoreductase chain 4L; NADH dehydrogenase subunit 4L
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-98
Protein Length
full length protein
Species
Propithecus diadema diadema (Diademed sifaka)
Target Names
Target Protein Sequence
MPSIFTNIILAFATALLGTLVFRSHLMSSLLCLEGMMLSMFVLSTLIILNMHFTMSFMMP ILLLVFAACEAAVGLALLVMVSNTYGLDYIQNLNLLQC
Uniprot No.

Target Background

Function

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I). It catalyzes electron transfer from NADH through the respiratory chain, utilizing ubiquinone as the electron acceptor.

Protein Families
Complex I subunit 4L family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the biological significance of MT-ND4L in mitochondrial function?

MT-ND4L is a subunit of mitochondrial complex I, also known as NADH-ubiquinone oxidoreductase. This enzyme complex plays a critical role in oxidative phosphorylation, facilitating electron transfer from NADH to ubiquinone while simultaneously pumping protons across the inner mitochondrial membrane to generate a proton gradient essential for ATP synthesis . In Propithecus diadema diadema, MT-ND4L contributes to the structural stability and enzymatic activity of complex I. Studies on other organisms, such as Chlamydomonas reinhardtii, have shown that the absence of ND4L disrupts complex I assembly and suppresses enzymatic activity .

How can recombinant MT-ND4L be expressed and purified for experimental studies?

Recombinant MT-ND4L can be expressed in bacterial systems such as Escherichia coli, utilizing vectors with strong promoters and tags like His-tags for purification . The protein is typically purified using affinity chromatography methods, such as nickel-nitrilotriacetic acid (Ni-NTA) resin, followed by SDS-PAGE to confirm purity (>90%) . Researchers should optimize expression conditions, including temperature, induction time, and media composition, to maximize yield and solubility. Lyophilized recombinant protein can be stored at -20°C or -80°C with glycerol for long-term stability .

What are the challenges in studying MT-ND4L's role in mitochondrial complex I assembly?

One major challenge is the hydrophobic nature of MT-ND4L, which complicates its isolation and structural characterization . Additionally, mutations or deletions in ND4L can lead to incomplete assembly or functional impairment of complex I. Experimental models like Chlamydomonas reinhardtii, where homoplasmic mutations are non-lethal, provide valuable systems for studying these effects . Techniques such as RNA interference (RNAi) have been employed to suppress ND4L expression and analyze its impact on enzyme activity and assembly pathways .

How can RNA interference (RNAi) be used to investigate MT-ND4L function?

RNAi can be employed to knock down MT-ND4L expression by designing double-stranded RNA constructs targeting the gene sequence. For example, plasmids containing fragments of ND4L with introns can be constructed using PCR-amplified sequences and inserted into vectors with strong promoters . Transformants are selected based on phenotypic markers, and RNA blot analyses are used to confirm gene suppression . This approach allows researchers to study the physiological consequences of reduced ND4L expression on mitochondrial function.

What experimental models are suitable for studying MT-ND4L?

Experimental models include unicellular organisms like Chlamydomonas reinhardtii and multicellular species such as Propithecus diadema diadema . In algae like C. reinhardtii, nuclear-encoded homologs of ND4L facilitate genetic manipulation through techniques such as RNAi or point mutation insertion . Mammalian models require more sophisticated approaches due to the complexity of mitochondrial genetics and interspecies differences. Recombinant protein studies using bacterial expression systems also provide insights into structural properties .

How does MT-ND4L contribute to electron transport chain efficiency?

MT-ND4L stabilizes interactions within complex I subunits, ensuring efficient electron transfer from NADH to ubiquinone. Structural studies suggest that hydrophobic interactions between ND subunits influence enzyme activity . Loss-of-function mutations in ND4L impair electron transport efficiency, leading to reduced ATP production and increased reactive oxygen species (ROS) generation .

What techniques are available for analyzing MT-ND4L protein structure?

Techniques include X-ray crystallography, nuclear magnetic resonance (NMR), cryo-electron microscopy (cryo-EM), and computational modeling based on hydropathy profiles . Alpha-helix predictions using Protscale or Pepwheel programs help identify secondary structure elements critical for function . Blue native polyacrylamide gel electrophoresis (BN-PAGE) can be used to study protein complexes containing MT-ND4L .

Can codon optimization improve recombinant MT-ND4L expression?

Yes, codon optimization tailored to the host organism's codon usage frequency enhances translation efficiency and protein yield. For example, data from C. reinhardtii nuclear genes can guide codon selection for optimizing recombinant expression in bacterial systems . Computational tools like MITOPROT can assist in designing optimized sequences .

How does the absence of ND3 or ND4L affect mitochondrial respiratory chain complexes?

The absence of ND3 or ND4L prevents proper assembly of complex I, leading to suppressed enzyme activity and destabilization of other respiratory chain complexes like complex IV . Experimental suppression of these subunits using RNAi has demonstrated their essential roles in maintaining mitochondrial function .

What bioinformatics tools are useful for studying MT-ND4L?

Bioinformatics tools include MITOPROT for hydropathy analysis, Expasy's Protscale for alpha-helix predictions, Pepwheel for residue positioning along helices, and databases like GenBank for sequence retrieval . These tools facilitate structural modeling and functional predictions based on sequence data.

How can point mutations in MT-ND4L be introduced experimentally?

Point mutations can be introduced using site-directed mutagenesis techniques or genetic transformation methods like glass bead-mediated DNA delivery in C. reinhardtii . Mutated sequences are cloned into vectors for expression analysis or functional assays.

What are the implications of hydrophobicity modifications in nuclear-encoded ND subunits?

Hydrophobicity modifications influence protein sorting into mitochondria by reducing aggregation tendencies during import processes . Nuclear-encoded homologs like NUO11 exhibit lower hydrophobicity compared to their mitochondrion-encoded counterparts, enhancing their compatibility with cellular machinery .

How does MT-ND4L interact with other subunits within complex I?

MT-ND4L forms hydrophobic interactions with adjacent subunits that stabilize complex I's tertiary structure and support electron transfer mechanisms . Disruption of these interactions through mutations or deletions compromises enzyme activity.

What experimental approaches can validate MT-ND4L's role in disease models?

Disease models involving mitochondrial dysfunctions can utilize RNAi-mediated knockdowns or point mutations targeting MT-ND4L genes to mimic pathological conditions . Functional assays measuring ATP synthesis rates or ROS production provide insights into disease mechanisms.

How do storage conditions affect recombinant MT-ND4L stability?

Recombinant proteins should be stored at -20°C/-80°C with protective agents like glycerol to prevent degradation during freeze-thaw cycles . Lyophilized forms offer extended shelf-life when properly reconstituted with buffers containing trehalose at pH 8.0 .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.