Recombinant Propithecus tattersalli NADH-ubiquinone oxidoreductase chain 4L (MT-ND4L)

Shipped with Ice Packs

In Stock

Cat. No.

BT2042796

Source

in vitro E.coli expression system

Synonyms

MT-ND4L; MTND4L; NADH4L; ND4L; NADH-ubiquinone oxidoreductase chain 4L; NADH dehydrogenase subunit 4L

Quick Inquiry

Description

Gene and Protein Structure

The MT-ND4L gene in Propithecus tattersalli encodes a 98-amino-acid protein critical for mitochondrial energy production. Key structural features include:

Amino Acid Sequence: MPSIFINIILAFATALLGTLVFRSHLMSSLLCLEGMmLSMFILSTLIILNMHFTMSFMMP ILLLVFAACEAAVGLALLVMVSNTYGLDYIQNLNLLQC .
Uniprot ID: Q7ISH5 .
Molecular Weight: ~11 kDa .
Membrane Localization: Multi-pass membrane protein embedded in the mitochondrial inner membrane .

The protein is part of the hydrophobic core of Complex I, contributing to electron transport and proton pumping .

Function in Biological Context

While the recombinant protein’s functionality has not been directly studied, its native counterpart in humans and other species participates in:

Process	Role
Electron Transport	Transfers electrons from NADH to ubiquinone, initiating oxidative phosphorylation .
Proton Pumping	Contributes to the proton gradient across the mitochondrial membrane, driving ATP synthesis .
Mitochondrial Health	Mutations in MT-ND4L in humans are linked to Leber’s Hereditary Optic Neuropathy (LHON) and metabolic disorders .

Suppliers and Availability

The recombinant protein is available from specialized biotechnology vendors:

Supplier	Product Code	Quantity	Notes
CUSABIO TECHNOLOGY LLC	CSB-CF745297PSJ-GB	50 µg	ELISA-compatible format .
ChemicalBook	Not explicitly listed	Custom inquiry	Requires direct consultation for bulk orders .

Research Gaps and Future Directions

Functional Characterization: No published studies validate the enzymatic activity of the Propithecus recombinant MT-ND4L.
Comparative Studies: Opportunities to compare structural and functional properties across primates (e.g., humans vs. Propithecus) .
Disease Modeling: Exploring whether Propithecus MT-ND4L mutations mirror human mitochondrial pathologies .

Product Specs

Form

Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order. We will prepare the product according to your needs.

Lead Time

Delivery time may vary based on the purchase method or location. Please consult your local distributors for specific delivery timeframes.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate this in advance as additional fees will apply.

Notes

Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.

Reconstitution

We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.

Shelf Life

The shelf life is influenced by various factors, including storage conditions, buffer components, storage temperature, and the intrinsic stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Storage Condition

Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.

Tag Info

The tag type will be determined during the manufacturing process.

We will determine the tag type during production. If you have specific tag requirements, please inform us, and we will prioritize the development of the specified tag.

Synonyms

MT-ND4L; MTND4L; NADH4L; ND4L; NADH-ubiquinone oxidoreductase chain 4L; NADH dehydrogenase subunit 4L

Buffer Before Lyophilization

Tris/PBS-based buffer, 6% Trehalose.

Datasheet

Please contact us to get it.

Expression Region

1-98

Protein Length

full length protein

Species

Propithecus tattersalli (Golden-crowned Sifaka) (Tattersall's sifaka)

Target Names

MT-ND4L

Target Protein Sequence

MPSIFINIILAFATALLGTLVFRSHLMSSLLCLEGMMLSMFILSTLIILNMHFTMSFMMP ILLLVFAACEAAVGLALLVMVSNTYGLDYIQNLNLLQC

Uniprot No.

Q7ISH5

Target Background

Function

Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) which catalyzes electron transfer from NADH through the respiratory chain, using ubiquinone as an electron acceptor.

Protein Families

Complex I subunit 4L family

Subcellular Location

Mitochondrion inner membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected

Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *

Name*

Email*

Phone

Country

Source

Quantity&Size*

Product Name

Message

Recombinant Propithecus tattersalli NADH-ubiquinone oxidoreductase chain 4L (MT-ND4L)

Description

Gene and Protein Structure

Function in Biological Context

Suppliers and Availability

Research Gaps and Future Directions

Product Specs

Target Background

Quick Inquiry

Category

Service