Recombinant Prorocentrum micans Photosystem Q (B) protein (psbA)

Shipped with Ice Packs
In Stock

Description

Functional Role in Photosynthesis

The D1 protein forms the QB-binding site of PSII, facilitating electron transfer during water splitting . Key functions include:

  • QB Binding: Stabilizes plastoquinone (QB) for electron transport .

  • Photoprotection: Targeted by herbicides like Irgarol 1051, which inhibit electron transport .

  • Environmental Adaptation: Cyanobacterial psbA gene families show differential expression under light stress, suggesting a role in optimizing PSII under varying conditions .

3.1. Herbicide Resistance Studies

  • Recombinant psbA proteins are used to study binding affinities of PSII inhibitors (e.g., Irgarol 1051) through competitive assays .

  • Mutagenesis studies reveal amino acid substitutions (e.g., Phe255→Ser) that confer herbicide resistance .

3.2. Environmental Monitoring

  • psbA metagenomic analyses track phytoplankton community responses to pollutants, linking gene diversity to ecosystem health .

Comparative Insights from Related Species

Recombinant psbA proteins from diverse species highlight evolutionary conservation and functional divergence:

SpeciesKey FeatureReference
Synechococcus 7942D1 isoform switching under high-light stress
Prochlorococcus marinuspsbA gene optimization for low-light marine environments
Porphyridium cruentumChl a/zeaxanthin binding in LHCI complexes

Technical Considerations

  • Stability: Repeated freeze-thaw cycles degrade the protein; working aliquots stored at 4°C retain activity for ≤1 week .

  • Activity Assays: Requires reconstitution with cofactors (e.g., Mn²⁺, Ca²⁺) for functional studies .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order remarks. We will accommodate your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery times, please consult your local distributors.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate with us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
For ease of handling, it is recommended to briefly centrifuge the vial prior to opening to ensure the contents are at the bottom. Reconstitute the protein with deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquotation for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
psbA; Photosystem II protein D1; PSII D1 protein; Photosystem II Q(B protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-343
Protein Length
full length protein
Species
Prorocentrum micans (Red tide dinoflagellate)
Target Names
psbA
Target Protein Sequence
MKNSQAVTSLTWWSVVVAYIVSTNSRLYIGWFGVLLFPLIAVSTVAYVAAFILAPPVDID GIREPVSGSLLYSNNIITGAVIPSSNAIGVHFYPVWEAISNNEWLYNGGTYQFVVLHFLA AVLAWLGREYEYSFRLGMRPWIYLAFSAPVVAASAVFVVYPIGQGSFSDGMPLGISGTFN FMLVFQAEHNILMHPFHILGVSAVFGGSLFSAMHGSLVTSSLLSETASYDSLNAGYVFGQ EDETYAISAAHGYFGRLLFQYGSFNNSRSLHFFLAAWPVIGIWCTAIGVSTMAFNLNGLN FNQSLLDSSGHVVNSWADVVNRADLGMEVMHERNTHNFPLDLA
Uniprot No.

Target Background

Function
Photosystem II (PSII) is a light-driven water:plastoquinone oxidoreductase that utilizes light energy to extract electrons from H2O, generating O2 and a proton gradient subsequently used for ATP formation. It comprises a core antenna complex that captures photons, and an electron transfer chain that converts photonic excitation into charge separation. The D1/D2 (PsbA/PsbA) reaction center heterodimer binds P680, the primary electron donor of PSII, as well as several subsequent electron acceptors.
Protein Families
Reaction center PufL/M/PsbA/D family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the psbA protein and what is its function in Prorocentrum micans?

The psbA gene encodes the Photosystem II protein D1 (also known as the Q(B) protein), which plays a critical role in photosynthetic electron transport. In Prorocentrum micans, a marine dinoflagellate, this protein functions as a key component of Photosystem II with the enzyme classification EC 1.10.3.9 . The D1 protein is essential for binding plastoquinone at the Q(B) site and facilitating electron transfer during photosynthesis. It is particularly significant because it is the primary binding site for many herbicides that inhibit photosynthesis, including Irgarol 1051 .

What are the key characteristics of Prorocentrum micans as an organism?

Prorocentrum micans is a unicellular dinoflagellate species with the following characteristics:

CharacteristicDescription
Size35-70 μm long, 20-50 μm wide
MorphologyTear-drop to heart shaped, flattened with a winged apical spine (10 μm)
Cell structureBivalvate with a rugose surface covered with shallow depressions
Photosynthetic apparatusContains two golden-brown chloroplasts situated posteriorly
NucleusLarge, kidney-shaped, positioned posteriorly
EcologyMarine planktonic species, forms red tides
ToxicityNot confirmed to be toxic, but can cause shellfish mortality through oxygen depletion
Feeding behaviorMixotrophic, employs mucus-trap-assisted feeding

Prorocentrum micans is the type species of the genus Prorocentrum and is notable for being euryhaline (tolerant of varying salinities) and mixotrophic in its feeding strategy .

What are the optimal storage and handling conditions for recombinant Prorocentrum micans psbA protein?

For optimal storage and handling of recombinant Prorocentrum micans psbA protein:

  • Store the lyophilized powder at -20°C/-80°C upon receipt

  • After reconstitution, store working aliquots at 4°C for up to one week

  • For extended storage, add glycerol to a final concentration of 50% and store at -20°C/-80°C

  • Avoid repeated freeze-thaw cycles as this may compromise protein integrity

  • Prior to opening, briefly centrifuge the vial to bring contents to the bottom

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

These conditions help maintain protein stability and activity for research applications .

What reconstitution protocol is recommended for recombinant psbA protein?

The recommended reconstitution protocol for recombinant Prorocentrum micans psbA protein is:

  • Centrifuge the vial before opening to ensure all material is at the bottom

  • Reconstitute the lyophilized protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • For long-term storage, add glycerol to a final concentration of 5-50% (50% is recommended)

  • Aliquot the reconstituted protein to minimize freeze-thaw cycles

  • Store aliquots at -20°C/-80°C for extended storage or at 4°C for up to one week

This protocol helps maintain the structural integrity and functionality of the recombinant protein for experimental use .

How can researchers verify the purity and activity of recombinant psbA protein?

Researchers can verify the purity and activity of recombinant Prorocentrum micans psbA protein through several analytical methods:

  • Purity Assessment:

    • SDS-PAGE analysis (should show >90% purity)

    • Western blotting using anti-His tag or specific anti-psbA antibodies

    • Mass spectrometry to confirm molecular weight and sequence

  • Activity Verification:

    • Binding assays with known D1 protein ligands (e.g., herbicides like Irgarol)

    • Electron transport assays using artificial electron acceptors

    • Reconstitution into liposomes to assess membrane insertion and function

    • Circular dichroism to verify proper protein folding

    • Herbicide binding competition assays

  • Functional Analysis:

    • Incorporation into model membrane systems

    • Analysis of photosynthetic electron transport inhibition in the presence of PSII inhibitors

    • Comparison with native protein using spectroscopic methods

These methods collectively provide comprehensive verification of both protein purity and functional activity for research applications .

How is recombinant psbA protein utilized in photosynthesis research?

Recombinant Prorocentrum micans psbA protein serves multiple purposes in photosynthesis research:

  • Structural Studies: Provides material for crystallography and structural analysis of the D1 protein, particularly the Q(B) binding site architecture

  • Herbicide Research: Serves as a target for studying the binding mechanisms and effects of photosystem II inhibitors like Irgarol 1051

  • Evolutionary Studies: Enables comparative analysis of photosystem components across different photosynthetic organisms, including dinoflagellates, plants, and cyanobacteria

  • Functional Reconstitution: Allows for in vitro reconstitution of photosystem II complexes to study electron transport mechanisms

  • Mutation Analysis: Provides a platform for introducing site-directed mutations to understand structure-function relationships in photosynthetic electron transport

  • Environmental Adaptation Research: Helps understand how photosynthetic organisms adapt to environmental stressors through modifications in the D1 protein

  • Biomarker Development: Aids in developing molecular probes for environmental monitoring of dinoflagellate populations

These applications contribute significantly to our understanding of photosynthetic mechanisms and environmental adaptations.

How can psbA sequences be used for community-level analysis in marine environments?

The psbA gene sequences provide valuable tools for community-level analysis in marine environments:

  • Biodiversity Assessment: psbA gene fragments can be amplified from environmental samples to assess the diversity of photosynthetic organisms in marine ecosystems

  • Community Composition Analysis: Clone libraries containing psbA gene fragments can be created from the metagenome of marine communities to analyze species distribution and relative abundance

  • Pollution Impact Studies: Changes in psbA sequence composition can indicate community shifts in response to pollutants, as demonstrated in studies with the antifouling compound Irgarol 1051

  • Adaptation Monitoring: Analysis of psbA sequences can reveal molecular adaptations to environmental stressors, including pollution-induced community tolerance

  • Ecological Succession Tracking: Temporal changes in psbA sequence diversity can help track ecological succession in marine periphyton communities

  • Functional Potential Assessment: Predicted D1 protein sequences derived from psbA genes provide insights into the photosynthetic capabilities of microbial communities

  • Biogeographical Studies: Distribution patterns of psbA variants can inform biogeographical studies of photosynthetic microorganisms

This approach has been successfully used to analyze species composition and community tolerance in marine periphyton communities exposed to environmental pollutants .

What role does psbA play in dinoflagellate ecology and red tide formation?

The psbA protein plays several significant roles in dinoflagellate ecology and potentially in red tide formation:

  • Photosynthetic Efficiency: As a crucial component of photosystem II, the D1 protein encoded by psbA determines photosynthetic efficiency, which directly affects the growth rate and biomass accumulation of Prorocentrum micans populations

  • Environmental Adaptation: Variations in the psbA gene may confer selective advantages in different light conditions or nutrient environments, potentially contributing to bloom formation

  • Energy Production for Toxin Synthesis: Although Prorocentrum micans is not confirmed to be toxic , efficient photosynthesis supported by functional psbA provides energy for cellular processes that could include toxin production in other dinoflagellate species

  • Mixotrophic Lifestyle Support: The energy derived from photosynthesis (requiring functional psbA) enables the mixotrophic lifestyle of Prorocentrum micans, which includes both photosynthesis and phagotrophy through mucus-trap-assisted feeding

  • Bloom Sustainability: Efficient photosynthesis contributes to the sustainability of red tide blooms, which Prorocentrum micans is known to form in many parts of the world

  • Competitive Advantage: Optimized photosynthetic machinery may provide competitive advantages over other phytoplankton under specific environmental conditions, contributing to bloom dynamics

  • Ecological Interactions: Prorocentrum micans exhibits allelopathic effects that may inhibit diatom growth , and photosynthetic capacity (dependent on psbA function) likely influences these competitive interactions

Understanding the role of psbA in these ecological processes provides insights into red tide formation and dinoflagellate bloom dynamics.

How does the D1 protein structure from Prorocentrum micans compare with that of other photosynthetic organisms?

The D1 protein (encoded by psbA) from Prorocentrum micans shows both conserved features and unique characteristics when compared to other photosynthetic organisms:

Conserved Features:

  • The core functional domains involved in electron transport and quinone binding

  • Five transmembrane helices characteristic of D1 proteins across photosynthetic organisms

  • Key amino acid residues at the Q(B) binding site that interact with plastoquinone and herbicides

  • Binding motifs for manganese clusters in the oxygen-evolving complex

Unique Characteristics in Prorocentrum micans D1:

  • Specific amino acid substitutions in the Q(B) binding pocket that may affect herbicide sensitivity

  • Dinoflagellate-specific sequence elements that may reflect adaptation to marine environments

  • Potential differences in protein turnover domains, as D1 is known to have high turnover rates due to photodamage

  • Unique post-translational modification sites that may affect protein stability and function

Structural Comparisons:

  • While higher plants typically show 85-90% sequence identity in D1 proteins, dinoflagellates like Prorocentrum micans show greater divergence

  • The full-length 343 amino acid sequence of P. micans D1 protein contains regions of both high conservation and lineage-specific variations

  • The three-dimensional structure likely maintains the core catalytic functions while exhibiting adaptations specific to dinoflagellate photosynthesis

These structural differences reflect evolutionary adaptations to different photosynthetic niches and environmental conditions.

What mechanisms regulate psbA gene expression in Prorocentrum micans?

The regulation of psbA gene expression in Prorocentrum micans involves several complex mechanisms:

  • Light-Dependent Regulation:

    • Expression likely follows diurnal patterns with increased transcription during daylight hours

    • Photosynthetically active radiation (PAR) intensity modulates expression levels

    • Different wavelengths may differentially affect transcription rates

  • Transcriptional Control:

    • Dinoflagellate-specific transcription factors likely interact with the psbA promoter

    • The unique genome organization of dinoflagellates (with genes often organized in tandem arrays) affects transcriptional regulation

    • Trans-splicing mechanisms, common in dinoflagellates, may influence processing of psbA transcripts

  • Post-Transcriptional Regulation:

    • RNA editing processes may modify psbA transcripts

    • Stability of psbA mRNA is likely regulated by light conditions and cellular redox state

    • Small RNAs may play a role in fine-tuning expression levels

  • Translational Control:

    • Ribosome binding and translation efficiency are regulated by light conditions

    • Cellular energy status influences translation rates of psbA mRNA

    • Specific RNA-binding proteins likely regulate translation initiation

  • Protein Turnover Regulation:

    • D1 protein has a high turnover rate due to photodamage

    • Damaged D1 is degraded by specific proteases and replaced with newly synthesized protein

    • The balance between synthesis and degradation is tightly controlled by light conditions and photosynthetic activity

  • Environmental Response Elements:

    • Temperature, nutrient availability, and other environmental factors modulate expression

    • Stress response elements in the regulatory regions may respond to oxidative stress

    • Day-night cycles influence expression patterns due to the photosynthetic lifestyle

Understanding these regulatory mechanisms provides insights into how Prorocentrum micans adapts its photosynthetic machinery to changing environmental conditions.

How do environmental stressors affect psbA expression and D1 protein turnover?

Environmental stressors significantly impact psbA expression and D1 protein turnover in Prorocentrum micans:

  • Light Stress Effects:

    • High light intensity increases photodamage to D1 protein, accelerating turnover rates

    • Excessive light triggers upregulation of psbA transcription to replace damaged D1 protein

    • UV radiation causes specific damage patterns to the D1 protein, requiring specialized repair mechanisms

  • Temperature Impacts:

    • Elevated temperatures accelerate D1 turnover rates due to increased susceptibility to photodamage

    • Temperature extremes affect the translation efficiency of psbA mRNA

    • Cold stress may impair the insertion of newly synthesized D1 into thylakoid membranes

  • Nutrient Limitation Responses:

    • Nitrogen limitation affects protein synthesis capacity, potentially limiting D1 replacement

    • Phosphorus limitation influences membrane composition, affecting D1 protein environment

    • Iron limitation impacts electron transport chain function, increasing oxidative stress on D1

  • Herbicide Exposure:

    • PSII inhibitors like Irgarol 1051 bind to the D1 protein, blocking electron transport

    • Chronic exposure may select for altered psbA sequences with reduced herbicide binding affinity

    • Herbicide binding accelerates reactive oxygen species production, increasing D1 damage

  • Oxidative Stress Mechanisms:

    • Environmental pollutants that increase oxidative stress accelerate D1 damage

    • The balance between damage and repair determines photosynthetic capacity under stress

    • Antioxidant systems play a crucial role in protecting D1 from excessive damage

  • Salinity Stress Adaptations:

    • As a euryhaline species , P. micans has adaptations for maintaining D1 function across salinity gradients

    • Salinity changes affect membrane fluidity and protein conformation, potentially altering D1 function

    • Osmotic stress response mechanisms interface with photosynthetic regulation

  • Adaptive Responses:

    • Chronic exposure to stressors may select for modifications in psbA sequence and regulation

    • Community-level adaptations have been observed in response to pollutants like Irgarol

    • The mixotrophic capacity of P. micans may provide metabolic flexibility during photosynthetic stress

Understanding these stress responses is crucial for predicting how climate change and anthropogenic pollutants will affect dinoflagellate photosynthesis and ecology.

What experimental approaches can assess the effects of psbA mutations on photosynthetic efficiency?

Several sophisticated experimental approaches can be employed to assess the effects of psbA mutations on photosynthetic efficiency:

  • Site-Directed Mutagenesis Systems:

    • Generation of recombinant psbA variants with specific mutations

    • Expression in heterologous systems such as E. coli

    • Reconstitution of mutated D1 protein into model membrane systems

  • Functional Assays:

    • Oxygen evolution measurements to quantify photosynthetic capacity

    • Chlorophyll fluorescence analysis (PAM fluorometry) to assess PSII efficiency

    • P700 absorbance changes to evaluate electron flow from PSII to PSI

    • Thermoluminescence to characterize charge recombination events in PSII

  • Biophysical Characterization:

    • Electron paramagnetic resonance (EPR) spectroscopy to analyze cofactor binding

    • Time-resolved fluorescence to measure energy transfer efficiency

    • Circular dichroism to assess protein secondary structure changes

    • Isothermal titration calorimetry to measure binding affinities of quinones and herbicides

  • Structural Analysis:

    • X-ray crystallography of reconstituted PSII complexes with mutated D1

    • Cryo-electron microscopy to visualize structural changes

    • Molecular dynamics simulations to predict functional impacts of mutations

    • Hydrogen-deuterium exchange mass spectrometry to assess conformational dynamics

  • Herbicide Binding Studies:

    • Competitive binding assays with labeled herbicides

    • IC50 determination for various PSII inhibitors

    • Structure-activity relationship analysis for herbicide resistance mutations

  • Photodamage and Repair Assessment:

    • Pulse-chase experiments to measure D1 turnover rates

    • Photoinhibition recovery assays following high light exposure

    • Quantification of reactive oxygen species production under various light conditions

  • In vivo Approaches:

    • Transplantation of modified psbA into model organisms using chloroplast transformation

    • Phenotypic characterization under various growth conditions

    • Competition experiments to assess fitness effects of mutations

These experimental approaches provide comprehensive insights into how specific mutations affect D1 protein function, photosynthetic efficiency, and ecological fitness.

What is the relationship between psbA sequence variation and tolerance to photosystem II inhibitors?

The relationship between psbA sequence variation and tolerance to photosystem II inhibitors is complex and multifaceted:

  • Target Site Modifications:

    • Specific amino acid substitutions in the Q(B) binding pocket can reduce herbicide binding affinity while maintaining plastoquinone binding

    • Key positions (notably amino acids 211, 219, 255, 264, and 275 in most numbering systems) are frequently associated with herbicide resistance

    • Even single amino acid changes can confer significant tolerance to specific classes of PSII inhibitors

  • Community-Level Adaptations:

    • Studies of marine periphyton communities exposed to Irgarol 1051 show that selection pressure results in altered psbA gene sequence compositions

    • Community tolerance to PSII inhibitors correlates with the prevalence of resistance-conferring mutations in the psbA gene pool

    • Metagenome analysis of psbA sequences can predict community-level tolerance to herbicides

  • Structure-Function Relationships:

    • The three-dimensional architecture of the Q(B) binding pocket determines both inhibitor specificity and resistance mechanisms

    • Different classes of PSII inhibitors interact with different subsets of amino acids in the binding pocket

    • Mutations must balance reduced herbicide binding with maintained plastoquinone binding efficiency

  • Ecological Consequences:

    • Herbicide-resistant psbA variants may have altered photosynthetic efficiency or electron transport kinetics

    • Fitness costs of resistance mutations may affect competitive ability in unpolluted environments

    • The prevalence of resistant variants reflects the balance between selection pressure and fitness costs

  • Cross-Resistance Patterns:

    • Some mutations confer resistance to multiple classes of PSII inhibitors

    • Other mutations provide specific resistance to certain chemical classes while maintaining sensitivity to others

    • Understanding cross-resistance patterns is crucial for predicting the ecological impact of pollution

  • Evolutionary Considerations:

    • The high conservation of the psbA gene across photosynthetic organisms reflects functional constraints

    • Convergent evolution of similar resistance mutations across diverse taxa indicates common resistance mechanisms

    • The rate of resistant mutant selection depends on mutation rates and selection pressure intensity

These relationships provide valuable insights for environmental monitoring, pollution impact assessment, and the development of sustainable antifouling strategies.

What controls should be included when using recombinant psbA protein in experimental studies?

When designing experiments with recombinant Prorocentrum micans psbA protein, researchers should include these essential controls:

  • Protein Quality Controls:

    • Denatured protein control to distinguish between specific and non-specific effects

    • Tag-only protein control (e.g., His-tag protein without psbA) to account for tag-related artifacts

    • Concentration gradient controls to establish dose-response relationships

    • Purity verification through SDS-PAGE to ensure >90% purity

  • Functional Controls:

    • Known PSII inhibitors (e.g., Irgarol 1051) as positive controls for binding studies

    • Plastoquinone or analogs as natural substrate controls

    • Heat-inactivated protein to distinguish enzymatic from non-enzymatic effects

    • Time-course controls to account for potential protein degradation during experiments

  • Species Comparison Controls:

    • Recombinant psbA from other species (e.g., Solanum bulbocastanum) for comparative studies

    • Native (non-recombinant) psbA protein when available to validate recombinant protein behavior

    • Different expression system controls if investigating expression system artifacts

  • Environmental Condition Controls:

    • pH range controls (neutral pH recommended)

    • Temperature stability controls

    • Light exposure controls (especially important for photosensitive proteins)

    • Buffer composition controls to account for ionic strength effects

  • Experimental Design Controls:

    • Technical replicates to assess experimental variability

    • Biological replicates using different protein batches

    • Vehicle controls for solvents used to dissolve test compounds

    • No-protein controls for all experimental systems

These comprehensive controls ensure experimental rigor and enable valid interpretation of results when working with this complex photosynthetic protein.

How can researchers optimize expression and purification of recombinant psbA protein?

Optimizing expression and purification of recombinant Prorocentrum micans psbA protein requires careful consideration of several factors:

  • Expression System Selection:

    • E. coli is commonly used for psbA expression

    • Consider specialized E. coli strains designed for membrane protein expression

    • Evaluate insect cell or yeast expression systems for improved protein folding

    • Test different promoter strengths to balance expression level with proper folding

  • Expression Conditions Optimization:

    • Induction temperature (lower temperatures often improve membrane protein folding)

    • Induction time and inducer concentration

    • Media composition (rich vs. minimal media)

    • Addition of specific chaperones to assist proper folding

    • Co-expression with other PSII components that interact with D1

  • Construct Design Considerations:

    • His-tag position optimization (N-terminal tags are commonly used)

    • Inclusion of cleavable tags if tag-free protein is required

    • Codon optimization for expression host

    • Inclusion of appropriate signal sequences if targeting to membranes is desired

    • Potential fusion partners to enhance solubility

  • Purification Strategy Development:

    • Two-step purification approach (e.g., affinity chromatography followed by size exclusion)

    • Optimization of imidazole concentration for elution from Ni-NTA columns

    • Detergent selection for membrane protein solubilization

    • Buffer optimization to maintain protein stability

    • Use of glycerol (up to 50%) in storage buffers

  • Quality Control Measures:

    • SDS-PAGE and western blotting to confirm identity and purity (>90%)

    • Mass spectrometry to verify molecular weight and sequence

    • Functional assays to confirm activity

    • Stability testing under various storage conditions

    • Batch-to-batch consistency validation

By systematically optimizing these parameters, researchers can enhance yield, purity, and functional quality of recombinant Prorocentrum micans psbA protein for experimental applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.