Recombinant Prospect Hill virus Envelope glycoprotein (GP)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All protein shipments default to blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for your reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is finalized during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
GP; Envelopment polyprotein; M polyprotein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
655-1142
Protein Length
Full Length of Mature Protein
Species
Prospect Hill virus (PHV)
Target Names
GP
Target Protein Sequence
DTVEIKTGWTDTAHGAGVIPLKSDLELDFSLPSSATYIYRRDLQNPANEQERIPFHFQLQ RQVIHAEIQNLGHWMDGTFNLKTSFHCYGACEKYAYPWQTAKCFLEKDYEFETGWGCNPG DCPGVGTGCTACGVYLDKLRSVGKVFKVISLKFTRRVCIQLGSEQSCKTIDSNDCLMTTS VKVCMIGTVSKFQPGDTLLFLGPLEEGGIIFKQWCTTTCHFGDPGDIMSTPQGMQCPEHT GAFRKKCAFATMPTCEYDGNTLSGYQRMLATRDSFQSFNITEPHITSNSLEWVDPDSSLK DHINLVVNRDVSFQDLSENPCQVGVAVSSIDGAWGSGVGFNLVCSVSLTECASFLTSIKA CDAAMCYGATTANLVRGQNTVHILGKGGHSGSKFMCCHSTECSSTGLTAAAPHLDRVTGY NVIDNDKVFDDGSPECGVHCWFKKSGEWLMGILSGNWMVVAVLVVLLILSIFLFSLCCPR RVVHKKSS
Uniprot No.

Target Background

Function
Glycoproteins N and C, present on the virion surface, interact to mediate attachment to host cell receptors, initiating virion internalization primarily via clathrin-dependent endocytosis. Subsequently, they promote fusion between the viral and host endosomal membranes. Glycoprotein N contains an ITAM motif, potentially dysregulating normal immune and endothelial cell responses and contributing to viral pathogenesis.
Protein Families
Hantavirus envelope glycoprotein family
Subcellular Location
[Glycoprotein N]: Virion membrane. Host Golgi apparatus membrane; Single-pass type I membrane protein. Host endoplasmic reticulum membrane; Single-pass type I membrane protein.; [Glycoprotein C]: Virion membrane. Host Golgi apparatus membrane; Single-pass type I membrane protein.

Q&A

What is the basic structure of PHV envelope glycoproteins?

PHV envelope glycoproteins, like other hantaviruses, consist of two major glycoproteins (Gn and Gc, historically called G1 and G2) that form surface spikes on the viral particle. These glycoproteins are expressed as a polyprotein precursor (GPC) that is cleaved by cellular proteases during translocation to the endoplasmic reticulum. Each glycoprotein contains a large globular domain, a hydrophobic transmembrane sequence, and a small C-terminal cytoplasmic tail. Nuclear magnetic resonance spectroscopy has shown that part of the Gn (G1) tail in PHV contains a double ββα-fold zinc finger structure with high similarity to that found in Andes virus (ANDV) . The square-shaped surface spikes on viral particles are made of four Gn and four Gc subunits forming heterodimeric complexes .

How do PHV glycoproteins compare structurally to other hantavirus glycoproteins?

PHV glycoproteins share the fundamental structural architecture of other hantavirus glycoproteins but have specific sequence variations that may affect their function. In particular, the Gn tail regions contain highly conserved motifs across different hantaviruses, with PHV showing notable similarity to ANDV in this region . While the core structure remains conserved, these sequence differences may influence cellular localization, interactions with host factors, and immunogenicity. The S1094 residue (using Hantaan virus numbering) located in the membrane-proximal C-terminal half of the Gc stem is highly conserved across hantaviruses including PHV , suggesting functional importance in viral entry and membrane fusion.

What are the primary functions of PHV envelope glycoproteins in viral pathogenesis?

PHV envelope glycoproteins serve several critical functions in the viral life cycle:

  • Viral entry: They mediate attachment to host cell receptors and facilitate viral entry, though PHV may interact differently with β3-integrins compared to pathogenic hantaviruses .

  • Virus assembly: The zinc finger motifs in the cytoplasmic tail of Gn play important roles in virus assembly .

  • Immune modulation: Unlike pathogenic hantaviruses, PHV glycoproteins do not effectively inhibit interferon responses, which may contribute to its non-pathogenic nature in humans .

  • Membrane fusion: The Gc protein, particularly its stem region containing the conserved S1094 residue, is critical for mediating fusion between viral and cellular membranes during entry .

What expression systems are most effective for producing recombinant PHV glycoproteins?

For research-grade recombinant PHV glycoproteins, several expression systems have been employed with varying advantages:

Mammalian cell systems: Human embryonic kidney (HEK293T) cells or Chinese hamster ovary (CHO) cells provide proper folding and post-translational modifications, particularly the complex glycosylation patterns native to hantavirus glycoproteins. These systems are preferred when native conformation is essential for functional or structural studies.

Vesicular stomatitis virus (VSV) vectors: Recombinant VSVs can be engineered to express PHV glycoproteins, similar to the approach used with Hantaan virus glycoproteins . This system allows for the production of viral particles displaying PHV glycoproteins on their surface, useful for viral entry studies.

Baculovirus-insect cell systems: These provide a good compromise between proper protein folding and higher yield compared to mammalian systems, though glycosylation patterns differ.

For optimal expression, considerations should be made for codon optimization and inclusion of appropriate signal sequences to ensure proper trafficking through the secretory pathway.

How can specific mutations enhance the expression and functionality of recombinant PHV glycoproteins?

Based on studies with Hantaan virus glycoproteins, strategic mutations in specific domains can significantly enhance expression and functionality. Two particular mutations identified in HTNV glycoproteins have shown promise:

  • Cytoplasmic tail mutations: Mutations analogous to the I532K in the cytoplasmic tail of HTNV Gn could potentially enhance cell surface expression of PHV glycoproteins . This relocalization from the Golgi to the plasma membrane improves incorporation into pseudotyped viral particles.

  • Stem region mutations: Mutations similar to S1094L in the membrane-proximal stem of HTNV Gc might work synergistically with cytoplasmic tail mutations to enhance functionality .

When designing recombinant PHV glycoproteins, researchers should consider these domains as targets for optimization through site-directed mutagenesis. Validation should include assessment of cellular localization, protein expression levels, and functional assays appropriate to research objectives.

What purification strategies yield the highest quality recombinant PHV glycoproteins?

Optimal purification strategies for recombinant PHV glycoproteins include:

  • Affinity chromatography: Using tags such as His6, FLAG, or Strep-tag II fused to the glycoproteins, followed by targeted proteolytic removal of tags if necessary.

  • Size exclusion chromatography: Particularly useful for separating properly folded oligomeric forms from aggregates or monomers.

  • Ion exchange chromatography: Helps remove contaminants with different charge properties.

A multi-step purification protocol typically yields the best results:

  • Initial capture using affinity chromatography

  • Intermediate purification using ion exchange

  • Polishing using size exclusion chromatography

Buffer optimization is critical, with typical formulations including:

  • 20-50 mM Tris-HCl or phosphate buffer (pH 7.2-8.0)

  • 150-300 mM NaCl to maintain solubility

  • 5-10% glycerol as a stabilizing agent

  • Potential inclusion of low concentrations (0.01-0.05%) of non-ionic detergents for stabilization

How can recombinant PHV glycoproteins be used to study viral entry mechanisms?

Recombinant PHV glycoproteins provide valuable tools for studying viral entry mechanisms through several experimental approaches:

Pseudotyped virus systems: VSV or lentiviral pseudotypes bearing PHV glycoproteins can be generated to study entry in a BSL-2 setting . These systems allow for quantitative measurement of entry efficiency using reporter genes (e.g., luciferase, GFP).

Cell-cell fusion assays: Cells expressing PHV glycoproteins can be co-cultured with target cells to assess fusion activity under different pH conditions, helping to characterize the fusion mechanism.

Receptor identification: Recombinant glycoproteins can be used in binding assays, pull-downs, or crosslinking experiments to identify cellular receptors or attachment factors.

Mutagenesis studies: Systematic mutations in glycoprotein domains can reveal functional regions critical for entry, similar to the studies performed with HTNV glycoproteins that identified key mutations enhancing cell surface expression .

What experimental designs best assess the immunogenicity of recombinant PHV glycoproteins?

To assess immunogenicity of recombinant PHV glycoproteins, consider these experimental approaches:

Animal immunization studies:

  • Use purified recombinant glycoproteins with appropriate adjuvants

  • Establish dosing schedule (typically primary immunization followed by 1-2 boosts)

  • Collect pre-immune and post-immunization sera at defined intervals

  • Analyze antibody responses by ELISA, neutralization assays, and epitope mapping

In vitro T-cell response assessment:

  • Isolate peripheral blood mononuclear cells (PBMCs) from immunized animals

  • Stimulate with recombinant glycoproteins or derived peptides

  • Measure T-cell proliferation, cytokine production (IFN-γ, IL-2, IL-4)

  • Analyze by flow cytometry for activation markers and intracellular cytokine staining

Cross-reactivity analysis:

  • Test immune sera against glycoproteins from pathogenic hantaviruses

  • Assess potential for cross-neutralization

  • Map conserved versus variable epitopes

Data should be analyzed for both humoral and cell-mediated responses, with particular attention to neutralizing antibody titers, which are critical for protective immunity.

How can researchers differentiate between correctly folded and misfolded recombinant PHV glycoproteins?

Differentiating correctly folded from misfolded recombinant PHV glycoproteins requires multiple complementary approaches:

Conformational antibody binding: Develop or use existing conformation-dependent monoclonal antibodies that recognize properly folded epitopes. Compare binding profiles between native virus-derived glycoproteins and recombinant versions.

Glycosylation analysis: Mass spectrometry and glycan-specific enzymatic digestions can verify proper glycosylation patterns, which often correlate with correct folding.

Biophysical characterization:

  • Circular dichroism (CD) spectroscopy to assess secondary structure content

  • Differential scanning calorimetry (DSC) or differential scanning fluorimetry (DSF) to measure thermal stability

  • Limited proteolysis to detect exposed versus protected regions

Functional assays:

  • Cell binding assays to verify receptor interaction capability

  • Pseudotype virus entry assays to confirm function in viral entry

  • Membrane fusion assays to test fusion activity of Gc

A multi-parameter assessment combining structural and functional analyses provides the most reliable determination of proper folding.

How do the structural differences between PHV and pathogenic hantavirus glycoproteins contribute to differential virulence?

The structural differences between PHV and pathogenic hantavirus glycoproteins that may contribute to differential virulence include:

Receptor binding domains: While pathogenic hantaviruses like ANDV and HTNV interact efficiently with β3-integrins to facilitate entry into endothelial cells, PHV glycoproteins may have structural differences that result in altered receptor binding preferences or affinities .

Glycoprotein cytoplasmic tails: The cytoplasmic tails of pathogenic hantavirus glycoproteins contain virulence determinants that inhibit interferon responses, particularly through disruption of INF-β and TBK-1 induction . PHV glycoproteins likely have structural differences in these regions that fail to effectively antagonize host immune responses.

Fusion machinery: Differences in the Gc protein, particularly in the stem region containing residues like S1094, may influence membrane fusion efficiency and consequently affect viral propagation in different cell types .

Glycosylation patterns: Variations in N-linked glycosylation sites between PHV and pathogenic hantavirus glycoproteins may affect immune recognition and evasion strategies.

Comparative structural analysis using techniques such as cryo-electron microscopy, X-ray crystallography, and hydrogen-deuterium exchange mass spectrometry would provide further insights into these structural determinants of virulence.

What are the key considerations when designing PHV glycoprotein-based vaccine candidates?

When designing PHV glycoprotein-based vaccine candidates, researchers should consider:

Antigen design strategies:

  • Full-length versus truncated constructs

  • Stabilization of pre-fusion conformations

  • Multimerization to enhance immunogenicity

  • Chimeric designs incorporating epitopes from pathogenic hantaviruses

Glycosylation engineering:

  • Preservation of key glycans for proper folding

  • Potential modification of immunodominant glycans that may shield critical neutralizing epitopes

Expression platform selection:

  • DNA vaccines encoding optimized PHV glycoproteins

  • Viral vectors (e.g., modified VSV , adenovirus)

  • Protein subunit vaccines with appropriate adjuvants

  • Virus-like particles displaying PHV glycoproteins

Immune response targeting:

  • Focus on eliciting neutralizing antibodies targeting conserved epitopes

  • Enhancement of T-cell responses for broader protection

  • Balance between immunogenicity and safety profile

Validation experiments:

  • In vitro neutralization against multiple hantavirus strains

  • Animal challenge models with appropriate surrogate endpoints

  • Assessment of durability of immune responses

The non-pathogenic nature of PHV makes its glycoproteins particularly attractive as a safer platform for hantavirus vaccine development, potentially offering cross-protection against pathogenic strains.

How do cellular trafficking pathways affect the maturation and function of recombinant PHV glycoproteins?

Cellular trafficking pathways significantly impact the maturation and function of recombinant PHV glycoproteins through several mechanisms:

ER processing and quality control:

  • Initial folding assisted by chaperones (BiP, calnexin, calreticulin)

  • Disulfide bond formation catalyzed by protein disulfide isomerases

  • N-linked glycosylation at consensus sequences (Asn-X-Ser/Thr)

  • Retention of misfolded proteins through ER-associated degradation (ERAD)

Golgi trafficking and retention:

  • Natural hantavirus glycoproteins are typically retained in the Golgi complex due to specific signals in their cytoplasmic domains

  • Glycan processing from high-mannose to complex-type glycans

  • Proteolytic processing of the GPC precursor to mature Gn and Gc

Plasma membrane transport:

  • Mutations in cytoplasmic domains (like I532K in HTNV Gn) can enhance transport to the cell surface

  • Cell surface expression is critical for incorporation into budding virions or pseudotypes

  • Signal-mediated endocytosis can regulate surface expression levels

Post-endocytic sorting:

  • Internalization from the plasma membrane

  • Potential recycling to the cell surface or targeting to lysosomes

  • Implications for glycoprotein turnover and antigen presentation

Understanding these pathways is crucial for optimizing expression systems. For instance, introducing mutations analogous to I532K in Gn and S1094L in Gc might relocalize PHV glycoproteins from the Golgi to the cell surface, enhancing their incorporation into pseudotyped particles and potentially increasing immunogenicity in vaccine applications .

What are common challenges in expressing recombinant PHV glycoproteins and how can they be addressed?

Common challenges in expressing recombinant PHV glycoproteins include:

Low expression levels:

  • Solution: Optimize codon usage for the expression system

  • Solution: Test different promoters and enhancer elements

  • Solution: Incorporate introns in expression constructs to enhance mRNA processing

  • Solution: Consider inducible expression systems to minimize toxicity

Protein misfolding and aggregation:

  • Solution: Lower expression temperature (28-30°C for mammalian cells)

  • Solution: Co-express chaperones or foldases

  • Solution: Add chemical chaperones to culture media (e.g., glycerol, DMSO at low concentrations)

  • Solution: Include stabilizing mutations based on structural analysis

Improper glycosylation:

  • Solution: Select appropriate cell lines with compatible glycosylation machinery

  • Solution: Engineer glycosylation sites based on structural models

  • Solution: Consider glycosylation inhibitors to produce more homogeneous products when glycans aren't critical for the application

Proteolytic degradation:

  • Solution: Include protease inhibitors during purification

  • Solution: Identify and mutate susceptible sites without affecting function

  • Solution: Optimize buffer conditions to minimize proteolysis

Golgi retention limiting surface expression:

  • Solution: Introduce mutations in the cytoplasmic tail of Gn (similar to I532K in HTNV)

  • Solution: Consider mutations in the stem region of Gc (similar to S1094L in HTNV)

  • Solution: Create chimeric constructs with trafficking signals from cell surface proteins

How can researchers accurately quantify and characterize the glycosylation patterns of recombinant PHV glycoproteins?

Accurate quantification and characterization of glycosylation patterns in recombinant PHV glycoproteins requires a multi-faceted approach:

Mass Spectrometry-Based Methods:

  • Liquid chromatography-mass spectrometry (LC-MS) of intact glycoproteins

  • Tandem MS (MS/MS) of glycopeptides after proteolytic digestion

  • Matrix-assisted laser desorption/ionization (MALDI)-MS of released glycans

  • Glycan profiling using hydrophilic interaction liquid chromatography (HILIC)

Enzymatic Approaches:

  • Sequential digestion with specific glycosidases:

    • PNGase F (removes N-linked glycans)

    • Endoglycosidase H (removes high-mannose and some hybrid glycans)

    • Neuraminidase (removes terminal sialic acids)

  • SDS-PAGE mobility shift analysis after enzymatic treatment

Lectin-Based Methods:

  • Lectin blotting with glycan-specific lectins

  • Lectin microarrays for high-throughput profiling

  • Lectin affinity chromatography for glycoform enrichment

Data Analysis and Quantification:

  • Glycopeptide identification using specialized software (e.g., Byonic, GlycoPeptideSearch)

  • Relative quantification based on extracted ion chromatograms

  • Site-specific glycosylation analysis

  • Comparison with glycan databases and standards

For PHV glycoproteins, particular attention should be paid to distinguishing between high-mannose glycans (indicative of ER retention or Golgi processing defects) and complex glycans (indicative of proper trafficking through the Golgi apparatus), as this can provide insights into proper folding and trafficking.

What experimental controls are essential when studying the immunological properties of recombinant PHV glycoproteins?

Essential experimental controls for studying immunological properties of recombinant PHV glycoproteins include:

Protein Quality Controls:

  • Purity assessment: SDS-PAGE, size exclusion chromatography

  • Conformational integrity: Native PAGE, conformation-specific antibodies

  • Endotoxin testing: Limulus amebocyte lysate (LAL) assay to ensure immunological responses aren't due to contaminants

Immunization Controls:

  • Adjuvant-only groups to distinguish adjuvant from antigen-specific responses

  • Irrelevant protein controls (similar size/structure but unrelated)

  • Denatured glycoprotein samples to identify conformation-dependent responses

  • Glycosylation variants to assess the contribution of glycans to immunogenicity

Assay-Specific Controls:
For ELISA:

  • Pre-immune sera to establish baselines

  • Secondary antibody-only controls

  • Positive control sera from animals exposed to live virus

  • Cross-reactivity controls using related hantavirus glycoproteins

For neutralization assays:

  • Pseudotypes bearing unrelated viral glycoproteins

  • Serial dilutions to establish neutralization curves

  • Competing antibodies of known specificity

For T-cell assays:

  • Unstimulated cells as negative controls

  • Mitogen-stimulated cells as positive controls

  • Peptide pools from unrelated proteins

  • MHC blocking antibodies to confirm specificity

Data Interpretation Controls:

  • Technical replicates (minimum of three)

  • Biological replicates (different protein preparations)

  • Statistical analysis with appropriate tests for significance

  • Dose-response relationships to establish specificity

Implementing these controls enables accurate interpretation of results and enhances reproducibility across different research settings.

How do antibodies against PHV glycoproteins cross-react with other hantavirus glycoproteins?

The cross-reactivity of antibodies against PHV glycoproteins with other hantavirus glycoproteins is determined by the conservation of epitopes across different hantavirus species. Based on available research:

Conserved epitopes in Gc:
The Gc protein contains several highly conserved regions across hantaviruses, particularly in the fusion domain and stem region. Antibodies targeting these regions often show broad cross-reactivity. The conserved S1094 residue and surrounding sequences in the Gc stem represent potential targets for cross-reactive antibodies .

Variable epitopes in Gn:
The Gn protein tends to be more variable among hantaviruses, though certain structural elements like the zinc finger motif in the cytoplasmic tail show high conservation between PHV and ANDV . Antibodies targeting these conserved elements may exhibit cross-reactivity against specific hantavirus species.

Cross-neutralization patterns:
Antibodies against PHV glycoproteins typically show stronger cross-neutralization against other non-pathogenic hantaviruses compared to pathogenic ones. This hierarchy of cross-reactivity often follows phylogenetic relationships among hantaviruses.

When designing experiments to assess cross-reactivity:

  • Use a panel of recombinant glycoproteins or pseudotyped viruses representing diverse hantavirus species

  • Employ both binding (ELISA, Western blot) and functional (neutralization) assays

  • Map epitopes recognized by cross-reactive antibodies using peptide arrays or competition assays

  • Correlate cross-reactivity patterns with sequence conservation across different hantavirus glycoproteins

What methodological approaches best measure the structural integrity of recombinant PHV glycoproteins?

To accurately measure the structural integrity of recombinant PHV glycoproteins, researchers should employ a combination of biophysical, biochemical, and functional approaches:

Biophysical techniques:

  • Circular dichroism (CD) spectroscopy to assess secondary structure composition

  • Fourier-transform infrared (FTIR) spectroscopy for complementary secondary structure analysis

  • Fluorescence spectroscopy to monitor tertiary structure through intrinsic tryptophan fluorescence

  • Differential scanning calorimetry (DSC) to determine thermal stability and domain organization

  • Size exclusion chromatography with multi-angle light scattering (SEC-MALS) to verify oligomeric state

Biochemical approaches:

  • Limited proteolysis to probe accessibility of cleavage sites

  • Disulfide mapping using non-reducing SDS-PAGE and mass spectrometry

  • Glycosylation site occupancy analysis using PNGase F treatment and MS

  • Western blotting with conformation-specific antibodies

  • Blue native PAGE to assess native oligomeric assemblies

Functional assays:

  • Cell binding assays to verify receptor recognition

  • Pseudotype neutralization assays with conformation-dependent neutralizing antibodies

  • Membrane fusion assays to test functional activity of Gc

  • Surface plasmon resonance (SPR) to measure kinetics of antibody binding

Structural analysis:

  • Negative-stain electron microscopy to visualize glycoprotein complexes

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) to probe protein dynamics

  • Small-angle X-ray scattering (SAXS) for solution structure determination

A comprehensive assessment would involve multiple complementary techniques, comparing results between recombinant PHV glycoproteins and native controls when available.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.