Recombinant Prosthecochloris aestuarii ATP synthase subunit a 2 (atpB2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them when placing the order. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchase method or location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please communicate with us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize the development of the specified tag.
Synonyms
atpB2; Paes_2247; ATP synthase subunit a 2; ATP synthase F0 sector subunit a 2; F-ATPase subunit 6 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
34-324
Protein Length
Full Length of Mature Protein
Species
Prosthecochloris aestuarii (strain DSM 271 / SK 413)
Target Names
atpB2
Target Protein Sequence
AEAPAEAVHAEAAAHAEGGHESAGDVIMHHILDTGVMSFEPFGEVHLPQIVIGGFDISIT RHVVMMWIASAILLVVFLLVGNRYKTMTSRQAPGGMANAMEALVEFIRLDVAKSNIGAGY EKHLPYLLTVFAFILLLNLLGLVPYGATATGNINVTLTLAVFTFFITQVASLKAHGIKGY LAHLTAGTHWALWIIMIPIEIIGLFTKPFALTVRLFANMTAGHIVILSLIFISFILKSYI VAMFVSVPFSIFIYLLEIFVAFLQAFIFTMLSALFIGLATAHEGHEGEAAH
Uniprot No.

Target Background

Function
This protein is a key component of the proton channel and plays a direct role in the translocation of protons across the membrane.
Database Links
Protein Families
ATPase A chain family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Prosthecochloris aestuarii and why is its ATP synthase of interest?

Prosthecochloris aestuarii is a green sulfur bacterium originally isolated from brackish lagoons located in Sasyk-Sivash and Sivash. It belongs to the Chlorobiaceae family and serves as the type species for Group 4 of green sulfur bacteria . This organism is characterized by the presence of "prosthecae" on its cell surface, which house photosynthetic machinery within chlorosomes - distinctive structures of green sulfur bacteria .

The ATP synthase subunit a 2 (atpB2) from this organism is of particular interest because it represents an important component of the energy-generating machinery in these ancient photosynthetic bacteria. Studying this protein provides insights into the evolutionary adaptations of energy transduction systems in organisms that thrive in specialized ecological niches.

How does the recombinant P. aestuarii ATP synthase subunit a 2 differ from the native protein?

The recombinant P. aestuarii ATP synthase subunit a 2 (atpB2) is produced through heterologous expression systems to yield sufficient quantities for research purposes. While the amino acid sequence remains identical to the native protein (except for any tag additions), several important differences should be noted:

  • Expression system effects: The recombinant protein is produced in a non-native host, which may affect post-translational modifications and folding dynamics.

  • Tag additions: The recombinant version often contains affinity tags to facilitate purification. For the commercially available product, "the tag type will be determined during production process" .

  • Buffer composition: The recombinant protein is maintained in a Tris-based buffer with 50% glycerol, optimized specifically for this protein's stability .

  • Expression region: The commercial recombinant protein covers the expression region 34-324, representing the full-length protein .

What are the optimal storage and handling conditions for recombinant P. aestuarii ATP synthase subunit a 2?

For optimal stability and activity retention of recombinant P. aestuarii ATP synthase subunit a 2, researchers should follow these evidence-based protocols:

Storage ConditionTemperatureDurationNotes
Long-term storage-20°C to -80°CMonths to yearsStore in original buffer with 50% glycerol
Working aliquots4°CUp to one weekAvoid frequent freeze-thaw cycles

Handling recommendations:

  • The protein should be maintained in its Tris-based buffer with 50% glycerol for optimal stability .

  • Repeated freezing and thawing is not recommended as it may lead to protein denaturation and loss of activity .

  • For experimental work spanning several days, prepare working aliquots to be stored at 4°C for up to one week .

  • When diluting the protein for experiments, consider the buffer composition to maintain protein stability.

How can ATP synthase activity be measured in experimental settings?

ATP synthase activity can be quantitatively measured using several methodologies, with the continuous luciferase assay being one of the most sensitive and widely used approaches:

Continuous Luciferase Assay Protocol:

  • Reconstitute the ATP synthase in proteoliposomes to create a functional membrane-embedded complex.

  • In a white flat-bottomed 96-well microtiter plate, combine 275 μl of proteoliposomes containing the reconstituted ATP synthase with 20 μL ATP Bioluminescence Assay Kit reagent .

  • Record a baseline for 3 minutes at 37°C using a luminometer.

  • Initiate ATP synthesis by adding 0.5 mM ADP and 2 μM valinomycin (final concentrations) .

  • Monitor the emitted light continuously, which correlates directly with ATP production.

  • Perform all measurements in triplicates from three independent experiments for statistical validity .

For investigating the impact of different driving forces on ATP synthesis, the following modifications can be implemented:

  • To study Δψ (membrane potential) effects: Vary KCl concentrations between internal (liposome) and external buffers .

  • To study ΔpNa (sodium gradient) effects: Manipulate NaCl concentration differentials .

  • To study combined effects (μNa+): Maintain constant Δψ while varying ΔpNa .

What role does the ATP synthase play in the bioenergetics of P. aestuarii?

The ATP synthase in P. aestuarii plays a crucial role in the organism's energy conservation strategy. As a green sulfur bacterium, P. aestuarii employs anoxygenic photosynthesis where light energy is converted to chemical energy through a series of redox reactions.

The ATP synthase complex utilizes the proton motive force generated during photosynthesis to synthesize ATP by the following mechanism:

  • Light energy is captured by chlorosomes located within the prosthecae appendages .

  • This energy drives electron transport that pumps protons across the membrane, generating a proton gradient.

  • The ATP synthase subunit a 2 (atpB2) works as part of the membrane-embedded F0 sector, which forms the proton channel.

  • Proton flow through this channel drives the rotation of the c-ring, which couples to the F1 sector.

  • This mechanical rotation drives conformational changes in the catalytic sites of the F1 sector, leading to ATP synthesis.

Notably, green sulfur bacteria like P. aestuarii can operate ATP synthesis at remarkably low driving forces, similar to what has been observed in anaerobic archaea. Research shows that ATP synthases with V-type c subunits can synthesize ATP at physiologically relevant driving forces of 90 to 150 mV, which is significant for understanding bioenergetics in organisms living near the thermodynamic limit of ATP synthesis .

How do P. aestuarii ATP synthase mechanisms differ from those of other organisms?

The ATP synthase of P. aestuarii represents an interesting case study in the evolution of bioenergetic systems. Several key differences distinguish it from other organismal ATP synthases:

Organism TypeATP Synthase TypeIon SpecificityDriving Force ThresholdStructural Features
P. aestuarii (GSB)F-typeH+Lower (can operate at limited Δp)Contains atpB2 subunit
E. coli (model bacterium)F-typeH+HigherLacks specialized adaptations for low-light environments
Anaerobic archaeaA/V-type hybridNa+ or H+As low as 90-150 mVUnusual motor subunit c configuration

P. aestuarii, as a green sulfur bacterium, has evolved specific adaptations that allow its ATP synthase to function effectively in low-light environments where energy availability is limited. This represents an evolutionary adaptation to its ecological niche.

Research on ATP synthases from ancient lineages has challenged previous expectations about the capacity of certain motor configurations to synthesize ATP. Contrary to theoretical predictions, enzymes with V-type c subunits have demonstrated the ability to synthesize ATP at surprisingly low driving forces .

What experimental approaches can be used to study the interaction between P. aestuarii ATP synthase and other proteins in energy transduction pathways?

Investigating protein-protein interactions within the energy transduction pathway of P. aestuarii requires sophisticated methodological approaches:

1. Co-immunoprecipitation with recombinant atpB2:

  • Express the recombinant ATP synthase subunit a 2 with an affinity tag.

  • Use the tagged protein as bait to pull down interaction partners from P. aestuarii lysates.

  • Identify co-precipitated proteins through mass spectrometry.

2. Proximity-based labeling techniques:

  • Fuse ATP synthase subunit a 2 with enzymes like BioID or APEX2.

  • Express the fusion protein in P. aestuarii or a model organism.

  • After activation, the enzyme will biotinylate nearby proteins.

  • Purify and identify biotinylated proteins to map the interactome.

3. Reconstitution studies:

  • Purify individual components of the photosynthetic and ATP synthesis machinery.

  • Reconstitute them into liposomes in defined combinations.

  • Measure functional outputs (ATP synthesis, ion transport) to assess cooperative effects.

4. Cross-linking mass spectrometry:

  • Apply chemical cross-linkers to intact P. aestuarii cells or isolated membrane fractions.

  • Digest and analyze cross-linked peptides by mass spectrometry.

  • Map interaction interfaces between ATP synthase and other proteins.

These approaches can help elucidate the functional integration of ATP synthase within the broader context of energy transduction in P. aestuarii.

How might the syntrophic relationships of P. aestuarii influence ATP synthase function and evolution?

P. aestuarii and other green sulfur bacteria have been found to form syntrophic relationships with sulfur- and sulfate-reducing bacteria . These ecological associations likely have profound implications for ATP synthase function and evolution:

Metabolic Interdependencies:
Green sulfur bacteria like P. aestuarii oxidize sulfide during photosynthesis, depositing elemental sulfur globules outside the cells . This process creates a niche for sulfur- and sulfate-reducing bacteria, which can utilize these sulfur deposits. This relationship has been observed in enrichment cultures where Prosthecochloris species were found alongside sulfate-reducing bacteria like Halodesulfovibrio .

Evolutionary Implications for ATP Synthase:

  • Specialized ion gradients: The syntrophic relationship may create unique ionic microenvironments that influence the ion specificity of ATP synthase.

  • Adaptation to fluctuating energy availability: The dependency on partner organisms might have selected for ATP synthases capable of functioning under varying energetic conditions.

  • Horizontal gene transfer potential: Close physical association between syntrophic partners increases the likelihood of horizontal gene transfer, potentially influencing the evolutionary trajectory of ATP synthase genes.

  • Functional optimization: The ATP synthase may have evolved specific features to optimize performance within the constraints imposed by the syntrophic relationship.

Research examining ATP synthase activity in the context of these syntrophic associations could provide valuable insights into how ecological relationships shape the evolution of core bioenergetic machinery.

What are common issues in experiments with recombinant P. aestuarii ATP synthase subunit a 2 and how can they be addressed?

Researchers working with recombinant P. aestuarii ATP synthase subunit a 2 often encounter several technical challenges. Here are evidence-based approaches to address these issues:

IssuePotential CausesSolutions
Low protein activityImproper folding, denaturationUse gentler purification methods; optimize buffer conditions; add stabilizing agents
AggregationHydrophobic interactions, improper storageInclude detergents in buffer; maintain glycerol at 50%; optimize salt concentrations
Difficult reconstitution into liposomesHydrophobicity, orientation issuesTry different lipid compositions; adjust protein:lipid ratios; use mild sonication
Inconsistent ATP synthesis measurementsVariable proton/ion gradientsCarefully control buffer compositions; ensure consistent liposome preparation
DegradationProtease contaminationAdd protease inhibitors; minimize freeze-thaw cycles; store at recommended temperatures

When troubleshooting activity assays specifically:

  • Ensure that all components of the ATP synthesis measurement system are functioning properly by including positive controls.

  • Verify that the membrane potential or ion gradient is established as expected by using appropriate indicator dyes or electrodes.

  • Consider that the recombinant subunit may need to be co-reconstituted with other ATP synthase components to achieve full functionality.

How can researchers optimize expression and purification of recombinant P. aestuarii ATP synthase subunit a 2?

Optimizing the expression and purification of this membrane protein requires careful consideration of multiple factors:

Expression System Selection:

  • E. coli-based systems: While commonly used, they may struggle with proper folding of this membrane protein.

  • Cell-free systems: Can help overcome toxicity issues associated with membrane protein overexpression.

  • Alternative hosts: Consider Pseudomonas or Rhodobacter species, which may provide a more suitable membrane environment.

Expression Optimization Protocol:

  • Clone the atpB2 gene (Paes_2247) into an expression vector with an appropriate promoter and affinity tag.

  • Transform into the selected expression host.

  • Test expression at different temperatures (16°C, 25°C, 30°C) to balance expression level with proper folding.

  • Induce expression with lower inducer concentrations for longer periods to promote proper folding.

  • Include membrane-stabilizing agents in the growth medium.

Purification Strategy:

  • Solubilize membranes with appropriate detergents (DDM has been successfully used for ATP synthase components) .

  • Purify using affinity chromatography (e.g., Ni²⁺-NTA for His-tagged constructs) .

  • Consider using a two-step purification process with ion exchange or size exclusion chromatography to increase purity.

  • Maintain protein in a stabilizing buffer containing 50% glycerol and appropriate detergent concentrations .

By carefully optimizing these parameters, researchers can improve both the yield and the functional quality of the recombinant protein.

What are emerging techniques for studying ATP synthase function in green sulfur bacteria?

Several cutting-edge methodologies are expanding our understanding of ATP synthase function in green sulfur bacteria like P. aestuarii:

1. Cryo-electron microscopy (cryo-EM):

  • Enables visualization of the complete ATP synthase complex in near-native conditions

  • Can resolve structural details to near-atomic resolution

  • Allows for studying different conformational states during the catalytic cycle

2. Single-molecule biophysical techniques:

  • Fluorescence resonance energy transfer (FRET) to track conformational changes

  • Magnetic tweezers to measure mechanical forces generated during ATP synthesis

  • Patch-clamp techniques to measure ion translocation at the single-molecule level

3. In situ structural studies:

  • Cellular tomography to visualize ATP synthase in its native membrane environment

  • Correlative light and electron microscopy (CLEM) to link structure with function

  • Mass photometry for measuring stoichiometry and assembly states

4. Advanced reconstitution systems:

  • Nanodiscs to study ATP synthase in a defined lipid environment

  • Microfluidic systems to precisely control ion gradients

  • Artificial cells to reconstitute complete energy transduction pathways

These emerging techniques promise to provide unprecedented insights into the structural dynamics and functional mechanisms of ATP synthase in green sulfur bacteria.

How can understanding P. aestuarii ATP synthase contribute to synthetic biology applications?

The unique properties of P. aestuarii ATP synthase, particularly its adaptation to function in specialized ecological niches, offer several promising avenues for synthetic biology applications:

Bioenergetic System Engineering:

  • The ability of ATP synthases from organisms like P. aestuarii to function at low driving forces (similar to what has been observed in archaea, 90-150 mV) could be harnessed to design minimal synthetic cells that operate with limited energy inputs.

  • Components of this ATP synthase could be incorporated into hybrid systems optimized for specific applications in bioenergy production.

Environmental Bioremediation:

  • Engineered systems incorporating P. aestuarii ATP synthase mechanisms could be developed for energy generation in sulfide-rich environments, coupling bioremediation with energy recovery.

  • The syntrophic relationships between P. aestuarii and sulfur-reducing bacteria could inform the design of synthetic microbial consortia for specialized environmental applications.

Biotechnological Applications:

  • Understanding the structural basis for P. aestuarii ATP synthase's function could inform the design of robust enzyme systems for industrial applications.

  • The protein's adaptation to specific ionic conditions might be exploited to create biosensors for environmental monitoring.

Fundamental Research Tools:

  • Engineered variants of P. aestuarii ATP synthase could serve as model systems for studying the principles of biological energy transduction.

  • The creation of minimal synthetic systems incorporating this ATP synthase could help elucidate the fundamental requirements for life's energy-generating systems.

By leveraging our understanding of this specialized ATP synthase variant, synthetic biologists can develop novel solutions for energy generation, environmental remediation, and biotechnological applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.