Recombinant Prosthecochloris aestuarii ATP synthase subunit b 2 (atpF2)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Prosthecochloris aestuarii ATP Synthase Subunit b 2 (atpF2)

Prosthecochloris aestuarii ATP synthase subunit b 2 (atpF2) is a component of the F(1)F(0) ATP synthase found in the bacterium Prosthecochloris aestuarii. F(1)F(0) ATP synthase produces ATP from ADP, utilizing a proton or sodium gradient. It's composed of two main structural domains: F(1), which contains the catalytic core outside the membrane, and F(0), which contains the proton channel within the membrane. These domains are connected by a central stalk and a peripheral stalk.

Function and Structure

During the ATP synthesis process, the catalytic domain of F(1) is linked to proton translocation via a rotary mechanism involving the central stalk subunits. The atpF2 subunit is part of the F(0) channel and contributes to the peripheral stalk, which connects F(1) to F(0). The structures of intact ATP synthase from Bacillus PS3 have been determined by cryo-EM at resolutions of 3.0, 3.0, and 3.2 Å, allowing construction of nearly complete atomic models for the entire complex .

Prosthecochloris aestuarii

Prosthecochloris aestuarii is a green sulfur bacterium (GSB) that is anaerobic and sometimes found in association with corals . Genomic analysis has revealed diversity in pigment synthesis and sulfur metabolism genes among different coral-associated Prosthecochloris species, suggesting adaptation to various coral microenvironments .

Genomic Information

The atpF2 gene in Prosthecochloris aestuarii is also referred to as Paes_2245. The protein sequence of the recombinant Prosthecochloris aestuarii ATP synthase subunit b 2 (atpF2) consists of 175 amino acids .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
atpF2; Paes_2245; ATP synthase subunit b 2; ATP synthase F(0 sector subunit b 2; ATPase subunit I 2; F-type ATPase subunit b 2; F-ATPase subunit b 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-175
Protein Length
full length protein
Species
Prosthecochloris aestuarii (strain DSM 271 / SK 413)
Target Names
atpF2
Target Protein Sequence
MLTSGIVILSGGLLDPNPGLIFWTAVTFVIVLLILKKFAWGPILGALEEREKAIQSSIDR AHTAKDEAEAALRKNKELLTKADAEAEKILREGKEYGEKLRADIVEKAHSEATKMISSAK EEIEQEKRRALDELRNEVADLAVQGAEKILMANLDADKQKAIVSSMIQDLSKHRN
Uniprot No.

Target Background

Function

F1F0 ATP synthase synthesizes ATP from ADP using a proton or sodium gradient. This enzyme comprises two domains: F1, the extramembrane catalytic core, and F0, the membrane proton channel. These domains are linked by a central and peripheral stalk. ATP synthesis in the F1 catalytic domain is coupled to proton translocation through a rotary mechanism involving the central stalk subunits. This protein is a component of the F0 channel and forms part of the peripheral stalk, connecting F1 and F0.

Database Links
Protein Families
ATPase B chain family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

How does the structure of ATP synthase subunit b 2 relate to its function?

The structure of ATP synthase subunit b 2 is directly linked to its functional role in the ATP synthase complex. According to computed structure models (AF_AFB4S6E4F1) available in the RCSB Protein Data Bank, the protein has a pLDDT (predicted Local Distance Difference Test) global score of 89.04, indicating a high confidence in the structural prediction . The protein adopts a primarily alpha-helical structure that enables it to serve as part of the peripheral stalk of the ATP synthase complex, connecting the F1 catalytic domain to the F0 membrane domain.

The protein's structure facilitates several key functions:

  • Anchors the ATP synthase complex in the membrane

  • Helps maintain the proper orientation of the F1 and F0 domains

  • Contributes to the stability of the entire complex during rotational catalysis

  • May participate in the regulation of ATP synthesis

These structural features are conserved across species, emphasizing their importance for proper ATP synthase function .

What are the key features of the atpF2 gene in Prosthecochloris aestuarii?

The atpF2 gene in Prosthecochloris aestuarii is located within the genome with the ordered locus name Paes_2245 . Based on genomic analysis of Prosthecochloris aestuarii DSM 271, this gene is part of an operon containing multiple ATP synthase subunit genes. Key features include:

FeatureDescription
LocusPaes_2245
Gene Length~525 bp (coding sequence)
Protein ProductATP synthase subunit b 2
Alternative NamesATP synthase F(0) sector subunit b 2, ATPase subunit I 2, F-type ATPase subunit b 2
FunctionComponent of F-type ATP synthase
Genomic ContextLocated in ATP synthase operon

Comparative genomic analysis with other green sulfur bacteria shows conservation of this gene, although with varying degrees of sequence similarity, reflecting evolutionary adaptations to different environmental niches .

How is atpF2 expression regulated in Prosthecochloris aestuarii?

The regulation of atpF2 expression in Prosthecochloris aestuarii is coordinated with other ATP synthase subunits to ensure proper stoichiometry for complex assembly. While specific regulatory mechanisms for atpF2 in P. aestuarii have not been extensively characterized in the provided literature, general principles of ATP synthase regulation in green sulfur bacteria suggest several key points:

  • Transcriptional control: The atpF2 gene is typically part of an operon containing multiple ATP synthase subunit genes, allowing coordinated expression.

  • Environmental responsiveness: Expression levels likely respond to environmental factors such as light intensity, sulfide availability, and energy demands.

  • Post-transcriptional regulation: RNA stability and translation efficiency may be regulated to fine-tune protein levels.

  • Protein degradation: Selective degradation of misfolded or excess proteins helps maintain appropriate stoichiometry.

The green sulfur bacteria, including P. aestuarii, have evolved specific regulatory mechanisms to optimize energy production under the anoxic, light-limited conditions they typically inhabit .

What methodological approaches are recommended for the expression and purification of Recombinant Prosthecochloris aestuarii ATP synthase subunit b 2?

Based on successful protein production strategies documented in the literature, the following methodological workflow is recommended for expression and purification of Recombinant Prosthecochloris aestuarii ATP synthase subunit b 2:

Expression System Selection:

  • E. coli is the preferred heterologous expression system, as demonstrated in multiple studies

  • BL21(DE3) or Rosetta strains are particularly suitable for membrane protein expression

  • Consider codon optimization for the E. coli expression system to enhance yield

Vector Design Considerations:

  • Include an N-terminal His-tag for purification purposes

  • Incorporate a protease cleavage site if tag removal is desired

  • Select a vector with an inducible promoter (T7 or tac)

Optimal Expression Protocol:

  • Transform expression vector into selected E. coli strain

  • Culture cells at 37°C until OD600 reaches 0.6-0.8

  • Induce protein expression with 0.5-1.0 mM IPTG

  • Reduce temperature to 18-25°C during induction phase

  • Continue expression for 16-18 hours

Purification Strategy:

  • Cell lysis: Use sonication or French press in buffer containing 50 mM Tris pH 8.0, 300 mM NaCl, 10% glycerol

  • Membrane fraction isolation: Centrifuge lysate at 20,000g, then ultracentrifuge supernatant at 100,000g

  • Solubilization: Resuspend membrane fraction in buffer containing 1-2% mild detergent (DDM or LDAO)

  • Affinity chromatography: Purify using Ni-NTA resin

  • Size exclusion chromatography: Final purification step to obtain homogeneous protein

Storage Recommendations:

  • Store in Tris/PBS-based buffer containing 6% trehalose at pH 8.0

  • Add 50% glycerol for long-term storage

  • Store at -20°C/-80°C and avoid repeated freeze-thaw cycles

This methodology has been validated to produce protein with >90% purity as determined by SDS-PAGE analysis.

How can computational approaches, particularly AlphaFold2, be utilized to study ATP synthase subunit b 2 structure and dynamics?

AlphaFold2 (AF2) and related computational approaches offer powerful tools for studying ATP synthase subunit b 2 structure and dynamics. The AF2 model for ATP synthase subunit b 2 from Prosthecochloris aestuarii (AF-B4S6E4-F1) has been generated with a high confidence score (pLDDT global: 89.04), indicating reliability of the predicted structure .

Recommended Computational Workflow:

  • Structure Prediction:

    • Generate initial models using AlphaFold2

    • Assess model quality using pLDDT scores and predicted aligned error (PAE) maps

    • Compare with homologous structures where available

  • Refinement and Validation:

    • Refine the predicted structure using molecular dynamics (MD) simulations

    • Calculate root mean square fluctuations (RMSF) to identify regions of flexibility

    • Validate structural features through comparison with experimental data

  • Dynamic Analysis:

    • Implement local frustration analysis to identify energetically strained regions

    • Apply normal mode analysis to identify functional motions

    • Calculate distance variation (DV) matrices from MD simulations to correlate with PAE maps

  • Functional Prediction:

    • Identify conserved residues and map them onto the structure

    • Predict protein-protein interaction interfaces

    • Simulate the impact of mutations on structure and dynamics

Limitations and Considerations:
While AF2 predictions are powerful, they have limitations for membrane proteins and multiprotein complexes. Research by AlphaFold researchers indicates that "the PAE maps from AF2 are correlated with the distance variation (DV) matrices from molecular dynamics (MD) simulations, which reveals that the PAE maps can predict the dynamical nature of protein residues" . For ATP synthase subunit b 2, areas with lower pLDDT scores may indicate functionally important flexible regions.

To enhance analysis, integrate multiple computational approaches:

  • Compare AF2 models with models generated by other methods

  • Supplement structure prediction with coevolutionary analysis

  • Implement combined MD-ML (molecular dynamics-machine learning) approaches for dynamic predictions

What strategies can be employed to study the interactions between ATP synthase subunit b 2 and other components of the ATP synthase complex?

Studying protein-protein interactions involving ATP synthase subunit b 2 requires a multi-faceted approach combining structural, biochemical, and genetic methodologies:

In Vitro Interaction Analysis:

  • Cross-linking Studies:

    • Chemical cross-linking with MS analysis to identify interaction sites

    • Zero-length cross-linkers for direct contact sites

    • Protocol optimization: Use membrane-permeable cross-linkers at 0.5-2 mM concentration

  • Pull-down Assays:

    • Immobilize purified His-tagged atpF2 on Ni-NTA resin

    • Incubate with cell lysate or purified ATP synthase components

    • Analyze bound proteins via SDS-PAGE and mass spectrometry

  • Surface Plasmon Resonance (SPR):

    • Immobilize atpF2 or potential binding partners on sensor chips

    • Measure binding kinetics (ka, kd) and affinity (KD)

    • Compare wild-type interactions with mutant variants

Structural Approaches:

  • Cryo-EM Analysis:

    • Purify intact ATP synthase complexes from P. aestuarii

    • Perform cryo-EM to visualize the position of subunit b 2

    • Apply sub-tomogram averaging to resolve different rotary states, similar to approaches used for mitochondrial ATP synthase

  • Hydrogen-Deuterium Exchange MS:

    • Compare deuterium uptake of isolated subunit b 2 versus complex-incorporated protein

    • Identify regions with altered solvent accessibility when in complex

Genetic and In Vivo Approaches:

  • Site-directed Mutagenesis:

    • Target conserved residues identified in the AF2 structure model

    • Assess the impact on complex assembly and function

    • Focus on residues with high pLDDT scores that are likely critical for structure

  • Bacterial Two-Hybrid Systems:

    • Adapt for membrane proteins using specialized vectors

    • Screen for interactions with other ATP synthase components

    • Verify with complementary approaches

Example Research Data from Similar Studies:

ApproachProtein-Protein InteractionKey Findings
Chemical Cross-linkingSubunit b - F1 α/β interfaceMultiple lysine residues at the N-terminal domain form contacts
Cryo-EMSubunit b within complete complexForms part of the peripheral stalk, contacts multiple subunits
MutagenesisConservative substitutions in C-terminal domainDisruption of α-helical structure abolishes F1 interaction

These methodologies provide complementary information about the structural organization and dynamics of ATP synthase assembly, offering insights into the specific role of subunit b 2 within the complex.

How does ATP synthase subunit b 2 from Prosthecochloris aestuarii compare to homologous proteins in other species?

Comparative analysis of ATP synthase subunit b 2 across species reveals important insights about evolutionary conservation and functional adaptation. The analysis of homologous proteins shows both conserved features critical for ATP synthase function and species-specific adaptations.

Functional Conservation:
Despite sequence divergence, key functional regions show higher conservation:

  • The C-terminal domain that interacts with the F1 sector shows higher sequence conservation

  • Membrane-spanning regions show conservation of hydrophobic character rather than exact sequence

  • Residues involved in dimerization are generally conserved

Evolutionary Insights:
The comparison between ATP synthase subunits from P. aestuarii and related green sulfur bacteria like P. ethylica provides insights into adaptive evolution. The analysis of genome sequences indicates that while core functions are conserved, specific adaptations have occurred in response to different environmental conditions .

Research Applications:
This comparative analysis has practical implications for researchers:

  • Identifying conserved regions as targets for site-directed mutagenesis

  • Understanding which structural features are essential versus adaptable

  • Designing chimeric proteins to investigate domain-specific functions

  • Developing species-specific antibodies by targeting divergent regions

The evolutionary divergence of ATP synthase subunit b 2 reflects the adaptation of P. aestuarii to its specific ecological niche as an anoxygenic phototroph, while maintaining the core functionality required for ATP synthesis.

What are the experimental challenges in investigating the rotary mechanism of ATP synthase in Prosthecochloris aestuarii?

Investigating the rotary mechanism of ATP synthase in Prosthecochloris aestuarii presents unique challenges that require specialized experimental approaches. Research into ATP synthase dynamics has revealed intricate molecular machinery that undergoes conformational changes during catalysis.

Technical Challenges and Solutions:

  • Membrane Protein Stability:

    • Challenge: Maintaining native structure during purification

    • Solution: Use gentle detergents (DDM, LMNG) and incorporate lipids during purification

    • Validation: Assess ATPase activity before and after purification to confirm functional integrity

  • Complex Assembly:

    • Challenge: Ensuring proper assembly of all subunits including atpF2

    • Solution: Co-expression strategies or gentle purification of intact complexes

    • Approach: Tagged subunits can be used to pull down intact complexes

  • Single-Molecule Visualization:

    • Challenge: Attaching fluorescent probes without disrupting function

    • Solution: Site-specific labeling at non-critical residues identified from structural models

    • Method: FRET pairs positioned to detect rotation can provide real-time measurements

  • Reconstitution Systems:

    • Challenge: Creating functional proteoliposomes with proper orientation

    • Solution: Controlled reconstitution methods with defined lipid compositions

    • Measurement: ATP-driven proton pumping assays with pH-sensitive dyes

Recent Methodological Advances:
Recent research on ATP synthase dynamics from other organisms provides valuable methodological frameworks that can be adapted for P. aestuarii:

  • Cryo-EM Approaches: Sub-tomogram averaging has successfully captured different rotary states of ATP synthase in mitochondria, revealing "six rotary positions of the central stalk, subclassified into 21 substates of the F1 head" . Similar approaches could be applied to P. aestuarii.

  • Time-Resolved Spectroscopy: Coupling rapid mixing techniques with spectroscopic methods can capture transient states during catalysis.

  • Computational Simulations: Molecular dynamics simulations based on AlphaFold2 models can provide insights into potential rotary mechanisms, with the understanding that "protein structures predicted by AF2 also convey information of the residue flexibility, i.e., protein dynamics" .

Research Roadmap:
A comprehensive investigation should follow this sequence:

  • Structure determination of the intact complex

  • Identification of rotary substates through cryo-EM

  • Single-molecule studies to measure rotation dynamics

  • Correlation of structural findings with biochemical activities

These approaches collectively provide a framework for investigating the complex rotary mechanism of ATP synthase in P. aestuarii, contributing to our understanding of this essential energy-converting enzyme in green sulfur bacteria.

How can mutational analysis be designed to probe the function of specific domains in ATP synthase subunit b 2?

Mutational analysis represents a powerful approach to investigate structure-function relationships in ATP synthase subunit b 2. Based on the AlphaFold2 structural model and sequence analysis, a systematic mutational strategy can be designed to probe specific functional domains.

Strategic Approach to Mutational Analysis:

  • Target Selection Based on Structural Domains:

    DomainResidue RangePredicted FunctionMutation Strategy
    N-terminal membrane domain1-35Membrane anchoringConservative hydrophobic substitutions
    Central dimerization region36-100Stator formationDisruptive charged substitutions
    C-terminal F1-binding domain101-175F1 interactionAlanine scanning
  • Types of Mutations to Consider:

    • Conservative substitutions: Test specific chemical properties

    • Non-conservative substitutions: Disrupt function completely

    • Deletion constructs: Remove entire domains to test essentiality

    • Chimeric constructs: Swap domains with homologs to test specificity

  • Practical Experimental Design:

    • Generate mutations using site-directed mutagenesis on expression plasmids

    • Express mutant proteins in E. coli using the methods outlined in FAQ #5

    • Assess protein expression, stability, and purification characteristics

    • Test functional properties through reconstitution experiments

Assessing Mutational Impact:

For each mutant, a comprehensive analysis should include:

  • Structural Integrity Assessment:

    • Circular dichroism to assess secondary structure

    • Thermal stability measurements to detect destabilization

    • Limited proteolysis to probe for structural changes

  • Protein-Protein Interaction Analysis:

    • Pull-down assays with other ATP synthase components

    • Surface plasmon resonance to quantify binding affinity changes

    • Cross-linking studies to identify altered interaction patterns

  • Functional Analysis:

    • ATP hydrolysis assays (if reconstituted with F1)

    • Proton translocation assays in proteoliposomes

    • ATP synthesis measurements in reconstituted systems

Example Mutation Strategy Based on Sequence Conservation:

Highly conserved residues identified through multiple sequence alignment of atpF2 homologs represent prime targets for mutation. For example:

  • Leucine residues in the dimerization domain that form the coiled-coil interface

  • Charged residues in the C-terminal domain that interact with the F1 sector

  • Glycine residues that may serve as flexibility points in the structure

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.