Recombinant Prosthecochloris aestuarii Cobalamin synthase (cobS)

Shipped with Ice Packs
In Stock

Description

Absence of Direct References

The search results focus on:

  • Cobalamin biosynthesis pathways in Salmonella typhimurium and Bacillus megaterium , which involve enzymes like CbiK and CbiX but not Prosthecochloris aestuarii.

  • Genomic studies of coral-associated Prosthecochloris (CAP) species, highlighting adaptations to coral skeletons (e.g., gas vesicles, sulfur metabolism) .

  • Recombinant cobS proteins from Escherichia coli O157:H7 , but not from Prosthecochloris aestuarii.

No publications or genomic data explicitly mention cobS in P. aestuarii.

Nomenclature or Taxonomic Confusion

  • cobS is a known gene in E. coli and other bacteria, encoding a cobalamin synthase involved in vitamin B₁₂ biosynthesis .

  • P. aestuarii is a green sulfur bacterium (GSB) with distinct metabolic pathways (e.g., autotrophy, sulfur oxidation) . Its cobalamin biosynthesis pathway may differ from E. coli or other model organisms.

B. Limited Research on P. aestuarii Metabolism

While genomic studies of CAP species (e.g., Candidatus Prosthecochloris isoporae) reveal specialized traits like CO oxidation and cbb₃-type cytochrome c oxidases , cobalamin synthase genes (e.g., cobS) are not highlighted.

Hypothetical Contextual Analysis

If cobS were present in P. aestuarii, its function would likely align with:

FunctionCobalamin Biosynthesis RoleRelevance to P. aestuarii
Cobalamin synthase (cobS)Catalyzes final steps of B₁₂ synthesisPotential role in anaerobic metabolism
Cobalt chelatase (CbiK)Inserts cobalt into corrinoid ringAnalogous to S. typhimurium CbiK

Recommendations for Further Research

  1. Targeted Genomic Screening: Sequence P. aestuarii genomes to identify cobS or analogous genes.

  2. Metabolic Pathway Reconstruction: Compare cobalamin biosynthesis genes between P. aestuarii and other GSB or model bacteria.

  3. Experimental Validation: Use heterologous expression systems (e.g., E. coli) to test P. aestuarii cobS activity.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes, and we will fulfill your request.
Lead Time
Delivery times may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timeframes.
Note: All protein shipments are standardly packed with blue ice packs. If you require dry ice shipping, please communicate with us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
cobS; Paes_1252; Adenosylcobinamide-GDP ribazoletransferase; Cobalamin synthase; Cobalamin-5'-phosphate synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-248
Protein Length
full length protein
Species
Prosthecochloris aestuarii (strain DSM 271 / SK 413)
Target Names
cobS
Target Protein Sequence
MLDGLVTAMRTLTVLSVPGKDADEFSRSLYWFPLVGLLLGLLQAALAWIGMVSQIPEFSA LLVLLSGVLLTRAIHADGLADLADGFFGGKTRESRLRIMKDPAVGSFGVIALILLFLFKW IALTRIVAHGQYEWIVSGIVLARFVQVVLASVMTYAREGEGTACRFVAGAGGWHVVVAAL FSLLILVLVMKMQRLPIVVALLATAVSGSLTGMLAAKKIHGVTGDVLGASSEMTEALVWC SALLLLFY
Uniprot No.

Target Background

Function
This enzyme catalyzes the joining of adenosylcobinamide-GDP and alpha-ribazole to produce adenosylcobalamin (Ado-cobalamin). It also synthesizes adenosylcobalamin 5'-phosphate from adenosylcobinamide-GDP and alpha-ribazole 5'-phosphate.
Database Links
Protein Families
CobS family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Cobalamin synthase (cobS) and what is its role in vitamin B12 biosynthesis?

Cobalamin synthase (cobS) is a critical enzyme in the final stages of cobalamin (vitamin B12) biosynthesis pathway. In bacterial systems, cobalamin synthase completes the synthesis by catalyzing the exchange of GMP with α-ribazole . The transformation of uroporphyrinogen III into cobalamin requires approximately 25 enzymes and can proceed through either aerobic or anaerobic pathways.

The aerobic pathway depends on molecular oxygen, with cobalt insertion occurring after the ring contraction process. In contrast, the anaerobic pathway functions without oxygen, and cobalt is inserted into precorrin-2, several steps before ring contraction .

For experimental studies investigating cobS function, researchers should employ:

  • Enzyme assays measuring the conversion of GDP-cobinamide to cobalamin

  • HPLC analysis with UV-visible detection for product characterization

  • Radioactive labeling to trace the incorporation of precursors

How does Prosthecochloris aestuarii synthesize cobalamin compared to other organisms?

Prosthecochloris aestuarii, as a green sulfur bacterium, likely utilizes the anaerobic pathway for cobalamin synthesis, which aligns with its ecological niche as an anoxygenic phototroph. Green sulfur bacteria (GSB) like P. aestuarii typically inhabit anaerobic, sulfide-rich environments .

Different Prosthecochloris species exhibit varying requirements for vitamin B12 as a growth factor , suggesting diversity in their cobalamin biosynthetic capabilities or efficiency. This variability makes P. aestuarii an interesting model for comparative cobalamin biosynthesis studies.

To investigate pathway-specific differences, researchers should employ:

  • Comparative genomic analysis to identify cobalamin synthesis gene clusters

  • Transcriptomic profiling under vitamin B12-limiting conditions

  • Isotope labeling experiments to trace precursor incorporation

  • Gene knockout studies to determine the essentiality of specific enzymes

What are the optimal expression conditions for recombinant P. aestuarii cobS?

Table 1: Optimization Parameters for Recombinant P. aestuarii cobS Expression

ParameterRange to TestConsiderations
Temperature15-37°CLower temperatures (16-20°C) often improve solubility
IPTG concentration0.1-1.0 mMLower concentrations may reduce inclusion body formation
Expression time4-24 hoursLonger times at lower temperatures may increase yield
Media compositionLB, TB, M9, auto-inductionRich media (TB) typically increases yield
Host strainBL21(DE3), Rosetta, Arctic ExpressRosetta for rare codon usage; Arctic Express for cold-adapted chaperones
Fusion tagsHis, MBP, GST, SUMOMBP and SUMO typically enhance solubility
Lysis bufferpH 7.0-8.5, 100-500 mM NaClOptimize based on theoretical pI of recombinant protein
Additives5-10% glycerol, 1-5 mM β-MEMay improve stability and reduce aggregation

When optimizing recombinant expression, a systematic approach testing multiple conditions is essential. Green sulfur bacterial proteins can be challenging to express due to their specialized metabolic adaptations. For initial expression trials, E. coli-based systems provide the most accessible platform, but alternative hosts should be considered if expression proves difficult.

What structural features characterize cobalamin synthase enzymes?

While specific structural data for P. aestuarii cobS is limited in the available search results, structural characterization would typically involve:

  • X-ray crystallography to determine three-dimensional structure

  • Site-directed mutagenesis of conserved residues to identify catalytic sites

  • Spectroscopic methods (circular dichroism, fluorescence) to analyze protein folding

  • Computational modeling based on homologous proteins

Bacterial cobalamin synthases generally contain nucleotide-binding domains similar to those found in other enzymes involved in the synthesis pathway. The search results indicate that some related proteins possess glycine-rich motifs that may be involved in nucleotide binding . These structural features are critical for the exchange reaction that completes cobalamin synthesis.

How does the cobS gene from P. aestuarii differ from other green sulfur bacteria?

Comparative genomic analysis reveals that Prosthecochloris species show metabolic differences between coral-associated Prosthecochloris (CAP) and non-coral-associated Prosthecochloris (non-CAP) clades . These differences likely extend to cobalamin synthesis genes including cobS.

For investigating cobS gene differences, researchers should implement:

Methodological Approach:

  • Multiple sequence alignment of cobS genes from various green sulfur bacteria

  • Phylogenetic analysis to determine evolutionary relationships

  • Structural prediction to identify functional domains

  • Synteny analysis to examine gene context and operon structure

Analytical Techniques:

  • dN/dS ratio analysis to detect selective pressure

  • Identification of conserved versus variable regions

  • Computational prediction of substrate binding sites

The pattern of gene presence/absence is generally conserved within each clade (CAP or non-CAP) but differs between clades , suggesting potential functional adaptations in cobalamin synthesis enzymes based on ecological niche.

What are the mechanistic differences between aerobic and anaerobic cobalamin synthesis pathways?

Table 2: Comparison of Aerobic and Anaerobic Cobalamin Synthesis Pathways

FeatureAerobic PathwayAnaerobic Pathway
Oxygen requirementDependent on O₂Functions without O₂
Cobalt insertion timingAfter ring contractionAt precorrin-2 stage (early)
Key genetic markerscobO, cobMcbiD, cbiG
Chelatase systemThree-protein complexSingle protein (CbiK/CbiX)
Ring contractionO₂-dependentO₂-independent
DistributionAerobic bacteriaAnaerobes including GSB

The search results indicate that two genes, cbiD and cbiG, are essential components of the anaerobic pathway and constitute genetic hallmarks that distinguish it from the aerobic pathway . Additionally, the cobalt chelatase systems differ significantly between pathways, with the anaerobic pathway utilizing ATP-independent chelatases like CbiK and CbiX .

For investigating these differences, researchers should employ:

  • Heterologous expression of pathway genes under controlled oxygen conditions

  • Metabolomic analysis to identify pathway intermediates

  • Isotope labeling to trace atom incorporation

  • Enzyme assays with oxygen-sensitive components in anaerobic chambers

How can site-directed mutagenesis of recombinant P. aestuarii cobS elucidate its catalytic mechanism?

Site-directed mutagenesis represents a powerful approach for understanding enzyme mechanisms. For P. aestuarii cobS, researchers should focus on:

Target Selection:

  • Conserved residues identified through multiple sequence alignment

  • Predicted active site residues from homology modeling

  • Metal-coordinating residues (histidine, cysteine)

  • Substrate binding pocket residues

Methodological Approach:

  • Design mutagenesis primers for targeted residues

  • Create single and combined mutations

  • Express and purify mutant proteins

  • Characterize kinetic parameters (kcat, Km) of each variant

  • Analyze structural effects using spectroscopic methods

The search results mention that some related proteins in the cobalamin synthesis pathway possess glycine-rich motifs that may be involved in nucleotide binding . These regions would be prime targets for mutagenesis studies to understand cobS substrate interactions.

What role does cobS play in P. aestuarii's adaptation to different ecological niches?

Prosthecochloris aestuarii has been found in diverse environments including hydrogen sulfide-rich mud, hot spring sediment, and coral skeletons . The relationship between cobS function and ecological adaptation can be investigated through:

Experimental Approaches:

  • Comparative analysis of cobS sequences from strains isolated from different environments

  • Expression profiling under conditions mimicking natural habitats

  • Construction of cobS knockout mutants to assess fitness in different conditions

  • Complementation studies with cobS variants from different ecological sources

P. aestuarii exhibits metabolic flexibility, including syntrophic anaerobic photosynthesis via direct interspecies electron transfer , which may influence its cobalamin requirements and synthesis capabilities in different environments.

The search results indicate that coral-associated and non-coral-associated Prosthecochloris show different metabolic capacities , which may extend to variations in cobalamin synthesis enzymes like cobS.

How do coral-associated and non-coral-associated P. aestuarii strains differ in terms of cobalamin synthesis?

Recent genomic analyses reveal substantial differences between coral-associated Prosthecochloris (CAP) and non-coral-associated Prosthecochloris (non-CAP) strains . These differences likely extend to cobalamin synthesis pathways.

Table 3: Comparative Features of CAP and non-CAP Prosthecochloris Strains

FeatureCoral-Associated ProsthecochlorisNon-Coral-Associated Prosthecochloris
HabitatCoral skeletonsDiverse anaerobic environments
Metabolic patternDistinct clade-specific patternsMore diverse metabolic capabilities
Evolutionary statusMore recent specializationAncestral forms
Genetic featuresUnique mobile genetic elementsMore stable genomes
Vitamin B12 requirementsPotentially different requirementsVariable among species

The search results indicate that P. aestuarii strains show variability in their vitamin B12 requirements as growth factors , suggesting potential differences in their cobalamin synthesis capabilities. Researchers investigating these differences should employ:

  • Comparative genomic analysis of cobalamin synthesis gene clusters

  • Transcriptomic profiling under vitamin B12-limiting conditions

  • Metabolomic analysis of cobalamin intermediates

  • Heterologous expression of cobS from both CAP and non-CAP strains

What are the major challenges in expressing active recombinant P. aestuarii cobS?

Expressing active recombinant proteins from green sulfur bacteria presents several challenges:

  • Codon usage bias between P. aestuarii and expression hosts

  • Protein solubility issues due to membrane association

  • Requirement for specific cofactors or metal ions

  • Potential toxicity to host cells

  • Proper folding in heterologous systems

To address these challenges, researchers should consider:

  • Using codon-optimized synthetic genes

  • Screening multiple expression tags (MBP, SUMO, GST)

  • Testing expression under microaerobic or anaerobic conditions

  • Co-expression with chaperone proteins

  • Inclusion of appropriate metal ions in growth media

How can analytical methods be optimized for characterizing cobS enzymatic activity?

Table 4: Analytical Methods for cobS Activity Characterization

MethodApplicationDetection LimitAdvantagesLimitations
HPLCProduct analysisLow nanomolarQuantitative, robustRequires standards
Mass spectrometryProduct confirmationPicomolarDefinitive identificationComplex sample prep
UV-Vis spectroscopyReaction monitoringMicromolarReal-time kineticsLower sensitivity
Radioisotope assaysSubstrate incorporationPicomolarHighest sensitivitySafety concerns
Coupled enzyme assaysIndirect measurementVariesContinuous monitoringPotential interference

For optimal characterization of cobS activity, researchers should develop assays that:

  • Directly measure the conversion of substrate to product

  • Account for potential inhibitors or activators

  • Control for oxygen sensitivity

  • Include appropriate controls for non-enzymatic reactions

  • Validate results using multiple analytical approaches

How might synthetic biology approaches enhance cobalamin production using P. aestuarii cobS?

Although commercial applications were not requested, the academic research potential of synthetic biology approaches includes:

  • Pathway engineering to optimize flux through cobalamin biosynthesis

  • Creation of chimeric enzymes combining beneficial features from multiple species

  • Expression of optimized cobS variants in photosynthetic chassis organisms

  • Development of light-regulated expression systems for cobS

  • Coupling cobS expression to cellular redox state for enhanced activity

Such approaches would advance our fundamental understanding of enzyme function while potentially enabling new research tools for studying cobalamin-dependent processes.

What computational approaches can predict substrate specificity of P. aestuarii cobS variants?

Advanced computational methods can provide valuable insights into cobS function:

  • Molecular dynamics simulations to model substrate binding

  • Quantum mechanics/molecular mechanics (QM/MM) calculations to model reaction mechanisms

  • Machine learning approaches to predict activity of engineered variants

  • Phylogenetic analysis to identify co-evolving residues

  • Network analysis to understand cobS interactions within the larger biosynthetic pathway

These computational approaches should be validated with experimental data from site-directed mutagenesis studies and enzymatic characterization.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.