Recombinant Prosthecochloris aestuarii Membrane protein insertase YidC (yidC)

Shipped with Ice Packs
In Stock

Description

Introduction to YidC and Its Biological Role

YidC is a universally conserved membrane protein insertase critical for the biogenesis of α-helical membrane proteins across bacteria, mitochondria, and chloroplasts . It facilitates membrane integration through two pathways:

  • Sec-dependent: Collaborates with the SecYEG translocon for insertion of multi-pass transmembrane proteins .

  • Sec-independent: Acts autonomously as an insertase for single-pass or small membrane proteins (e.g., Pf3 coat protein) .

In Prosthecochloris aestuarii, a green sulfur bacterium inhabiting marine and estuarine environments , YidC is hypothesized to play a conserved role in membrane protein biogenesis, though direct studies remain limited.

Key Functional Mechanisms

  • Insertase activity: YidC binds hydrophobic regions of substrate proteins, enabling their lateral release into the lipid bilayer .

  • Lipid scramblase activity: Rearranges membrane lipids to accommodate newly inserted proteins .

  • Chaperone-like folding: Stabilizes transmembrane helices during integration .

Recombinant Production of P. aestuarii YidC

While no direct studies on P. aestuarii YidC are available, recombinant YidC production in model organisms follows standardized protocols:

Expression and Purification

StepMethodologyReference Analog
CloningGene amplification from P. aestuarii genomic DNA; insertion into pET vector with N-terminal His-tag .E. coli YidC
ExpressionInduction with IPTG in E. coli C43(DE3) at 37°C .E. coli systems
SolubilizationDetergent extraction (e.g., Cymal-6) .Bacillus YidC
PurificationAffinity chromatography (Ni-NTA) and gel filtration .E. coli protocols

Functional Validation

  • Proteoliposome assays: Reconstitution into liposomes to test Sec-independent insertion (e.g., Pf3 coat protein) .

  • Crosslinking studies: Mapping interactions with substrate proteins .

Comparative Genomic Insights

P. aestuarii YidC shares homology with characterized YidC proteins:

OrganismKey FeaturesFunctional Overlap
Escherichia coli61 kDa; Sec collaboration; Pf3 insertion Substrate recognition, ΔΨ dependence
Bacillus subtilisSpoIIIJ/YidC2 paralogs; regulated by mifM Membrane potential utilization
Prosthecochloris spp.Genome-encoded YidC homologs Inferred Sec-independent activity

Research Challenges and Future Directions

  • Functional divergence: P. aestuarii YidC may exhibit unique adaptations for anaerobic phototrophy .

  • Interactome mapping: BioID or AP-MS could identify partners like YibN (enhances YidC activity in E. coli) .

  • Structural studies: Cryo-EM or MD simulations to resolve conformational dynamics .

Applications and Implications

  • Antimicrobial targeting: Essentiality of YidC in bacteria validates it as a drug target .

  • Biotechnological engineering: Optimizing membrane protein production in synthetic biology .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
yidC; Paes_2335; Membrane protein insertase YidC; Foldase YidC; Membrane integrase YidC; Membrane protein YidC
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-584
Protein Length
full length protein
Species
Prosthecochloris aestuarii (strain DSM 271 / SK 413)
Target Names
yidC
Target Protein Sequence
MDRNSVIGLVLISLIMIVWMQFMAPEKKPLQDIDKPAVSLQEEVSPVSDIPAAAATPESY GEFSAMSDGEEKLLTVDNEYFTAVLSSRGATLKSMMLKKHLDSSREQFNLIRKNDSGALS LFFLTQAGKQIDTRDLYFSTAVTESQVTVGADNQFSVTYRLDVAPEKNIVITYTFSGDSY AIGYDISMNGFASEIAGNEFQLQWDGGLVHSEKNDDDELHNSWAAAYMGGSLLKLDASDQ SKTYREEQSGVAGWVAARTKYFVAAMIPSSETEGVYLAGKRLAGEPFENYTTALKFRVPS DESSFKESLRLYVGPIDYNVLNALGVNLEKIMDFGWDWLTRPFAEYIILPIFDLLNKFIG NYGLIIIIFAFLIKLVTYPLTMASTKSMKKMSALQPMMKEIQEKYKDNPAKLQSELGRIY KEAGVNPLGGCLPVVLQMPLLFAMFYVFRSSIQLRQHGFLWANDLSVPDSILDFGFSIPL YGDHIALFPILMAVAVFLQQKITPTAQTNDQMKAMIYIFPVMMLLFFNNMPAGLGLYYLM FNVFSIAQTWYINKTASTDDLPALSPVVAAPPKAPKKKKNARKR
Uniprot No.

Target Background

Function
Essential for the insertion, proper folding, and complex formation of integral membrane proteins within the cell membrane. It plays a role in the integration of membrane proteins, both those dependent and independent of the Sec translocase complex, as well as some lipoproteins. It also assists in the folding of multispanning membrane proteins.
Database Links
Protein Families
OXA1/ALB3/YidC family, Type 1 subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is YidC and what are its functional roles in bacterial systems?

YidC belongs to a family of evolutionarily conserved membrane protein insertases that includes mitochondrial Oxa1p and chloroplast Alb3 protein. These proteins are essential for the membrane integration process of newly synthesized proteins that can function independently of the classical Sec machinery . In bacterial systems, YidC serves as a molecular facilitator that recognizes hydrophobic regions of membrane proteins and catalyzes their integration into the lipid bilayer in a transmembrane orientation.

The 61 kDa YidC protein in Escherichia coli is specifically involved in the insertion of membrane proteins rather than the translocation of exported proteins . Its fundamental role is to recognize the hydrophobic regions of newly synthesized membrane proteins and facilitate their proper orientation in the membrane. YidC can function either independently or in conjunction with the Sec translocase, depending on the substrate protein.

How does YidC structure relate to its membrane insertion function?

YidC contains multiple transmembrane domains with a large periplasmic domain between the first two transmembrane regions. This periplasmic domain is recognized by specific antibodies and generates a characteristic 42 kDa protease-resistant fragment during biochemical analysis . Recent structural studies have revealed important insights into how YidC functions:

  • Conserved residues, particularly a charged arginine, play crucial roles in membrane protein insertion

  • The protein may adopt different conformational states during the insertion process

  • YidC can exist in both monomeric and dimeric forms, with functional implications for each state

The arrangement of YidC's transmembrane segments creates a hydrophobic environment that facilitates the lateral movement of substrate proteins into the lipid bilayer. This structural architecture is essential for YidC's insertase function and distinguishes it from channel-forming translocases.

What experimental evidence supports YidC's role as an independent insertase?

Several key experimental approaches have demonstrated YidC's independent insertase function:

  • Reconstitution experiments: Purified YidC reconstituted into proteoliposomes can efficiently facilitate the insertion of Pf3 coat protein without additional factors

  • Quantitative analysis shows that approximately 150 Pf3 coat protein molecules can be inserted per YidC molecule, suggesting a catalytic mechanism rather than stoichiometric insertion

  • YidC-depleted cells show defects in membrane protein insertion while maintaining normal export of non-membrane proteins

  • Protease-treated inner membrane vesicles that are blocked for Sec-dependent transport still permit YidC-mediated insertion

These findings collectively establish YidC as a bona fide membrane protein insertase that can function independently of the Sec translocase for certain substrate proteins.

How do researchers differentiate between Sec-dependent and YidC-dependent insertion pathways?

Researchers employ several experimental strategies to distinguish between these pathways:

  • Conditional depletion strains: The JS7131 strain allows controlled depletion of YidC to assess protein insertion in its absence

  • Reconstituted systems: Comparing insertion into pure lipid vesicles versus YidC proteoliposomes reveals YidC-specific effects

  • Substrate variants: Mutations in substrate proteins can switch their insertion pathway dependence, as demonstrated with Pf3 coat protein variants

  • Protease treatment: Sec components can be selectively inactivated by protease treatment while preserving YidC function

  • Crosslinking approaches: These identify specific contacts between nascent chains and either Sec components or YidC

The experimental distinction between these pathways is crucial for understanding the complex process of membrane protein biogenesis in bacterial systems.

What are the optimal methods for recombinant expression and purification of Prosthecochloris aestuarii YidC?

Expression and purification of recombinant Prosthecochloris aestuarii YidC requires careful optimization of several parameters:

Expression system optimization:

  • Use E. coli strain BL21(DE3)pLysS with T7 RNA polymerase under inducible control

  • Add a C-terminal hexahistidine tag for affinity purification

  • Consider codon optimization for heterologous expression

  • Optimize induction conditions (temperature, IPTG concentration, duration)

Purification protocol:

  • Membrane isolation by differential centrifugation

  • Solubilization with mild detergents (DDM or LDAO)

  • Initial purification by metal affinity chromatography (Ni-NTA)

  • Further purification by ion exchange chromatography

  • Quality control by SDS-PAGE, Western blotting, and functional assays

The purification strategy should aim to maintain the native conformation of YidC, which is critical for retaining its insertase activity. Based on established protocols for E. coli YidC, purification to homogeneity can be achieved through a combination of affinity and ion exchange chromatography steps .

How can functional YidC proteoliposomes be reconstituted for in vitro studies?

Reconstitution of functional YidC into proteoliposomes involves several critical steps:

Proteoliposome preparation protocol:

  • Create a solubilized dry film of bacterial lipids (preferably E. coli lipids)

  • Resuspend in buffer (100 mM Na₂SO₄, HEPES pH 8.0)

  • Mix with purified YidC protein

  • Process through an extruder to generate uniform vesicles (0.25 μm diameter)

  • Collect proteoliposomes by centrifugation and resuspend in appropriate buffer (100 mM K₂SO₄)

Verification of reconstitution:

  • Analyze protein incorporation by SDS-PAGE

  • Determine YidC orientation using protease accessibility assays

  • Verify functional activity using model substrates like Pf3 coat protein

The optimal YidC density appears to be approximately 25 YidC molecules per liposome, corresponding to a protein:lipid ratio of 1:25,000 . This density supports efficient insertion of substrate proteins while maintaining membrane integrity.

YidC DensityInsertion EfficiencyNotes
<5 molecules per liposomeLowInsufficient for catalytic function
~25 molecules per liposomeOptimalSupports insertion of ~150 substrate molecules per YidC
>50 molecules per liposomeHigh but variablePotential aggregation effects

What evidence supports YidC dimerization and how does it affect function?

Recent research suggests that YidC may function as a dimer rather than exclusively as a monomer:

  • BN-PAGE analysis of native membrane vesicles reveals higher molecular weight YidC complexes consistent with dimers

  • Fluorescence correlation spectroscopy studies support oligomeric assembly

  • Single-molecule fluorescence photobleaching observations show multiple fluorophore bleaching steps, indicating multiple YidC molecules in close proximity

  • Chemical crosslinking experiments capture dimeric intermediates

The functional significance of YidC dimerization includes:

  • Formation of a protected environment for membrane protein insertion

  • Creation of a transmembrane pore when bound to ribosomes or ribosome-nascent chain complexes (RNCs)

  • Positioning of the conserved arginine residue within the pore rather than facing the lipid bilayer

  • Potential alternative insertion mechanism beyond the traditional insertase model

These findings suggest that YidC may have multiple functional states depending on its oligomeric organization, with important implications for understanding its mechanism of action.

How does ribosome binding affect YidC structure and function?

Ribosome binding induces significant conformational changes in YidC that alter its functional properties:

  • Electrophysiology experiments demonstrate that E. coli YidC forms an ion-conducting transmembrane pore upon binding to ribosomes or ribosome-nascent chain complexes

  • This pore formation is not observed with monomeric YidC structures, suggesting dimerization may be required for this function

  • In the dimeric model, conserved residues that interact with nascent chains point into the putative pore rather than toward the lipid environment

  • Ribosome binding may trigger conformational rearrangements that activate specific functional states of YidC

These findings suggest a novel model for YidC-assisted membrane protein insertion that differs from the classical insertase mechanism, where YidC may provide a protected channel for nascent chains entering the membrane.

What methodologies are most effective for studying YidC-substrate interactions?

Several complementary approaches can be employed to investigate YidC-substrate interactions:

Biochemical approaches:

  • Protease protection assays to monitor membrane insertion of substrates into YidC proteoliposomes

  • Sedimentation assays to quantify substrate binding to YidC-containing membranes

  • Detergent solubilization tests to assess integration stability

Biophysical techniques:

  • Electrophysiology to detect ion conductance through YidC complexes

  • Fluorescence correlation spectroscopy to analyze molecular dynamics

  • Single-molecule fluorescence techniques to track individual insertion events

Cross-linking strategies:

  • Site-specific photocrosslinking to map interaction interfaces

  • Chemical crosslinking to capture transient complexes

  • In vivo crosslinking during active protein synthesis

A powerful experimental approach combines purified YidC reconstituted into proteoliposomes with purified substrate proteins. For example, when 8 μg of purified Pf3 protein is added to YidC proteoliposomes and incubated at 37°C for 60 minutes, the majority becomes membrane-inserted and resistant to proteinase K digestion, demonstrating successful YidC-mediated insertion .

How can researchers assess YidC insertion activity quantitatively?

Quantitative assessment of YidC insertion activity requires careful experimental design:

In vitro insertion assay protocol:

  • Incubate purified substrate protein with YidC proteoliposomes

  • Sediment proteoliposomes to separate membrane-bound from unbound substrate

  • Treat with proteinase K to distinguish surface-bound from membrane-inserted protein

  • Analyze protected fragments by SDS-PAGE and appropriate detection methods

  • Include detergent controls to verify protease accessibility in disrupted membranes

Quantitative analysis parameters:

  • Insertion efficiency (percentage of added substrate that becomes protease-resistant)

  • Kinetics of insertion (time-course measurements)

  • YidC dependence (comparison with control liposomes lacking YidC)

  • Effect of YidC concentration on insertion rates

For example, experiments with Pf3 coat protein demonstrate that in YidC proteoliposomes, most of the substrate becomes protease-resistant, indicating efficient membrane insertion. When the membrane is disrupted with detergent, the protection is lost, confirming genuine membrane insertion rather than aggregation or non-specific binding .

What challenges exist in studying species-specific differences in YidC function?

Investigating species-specific aspects of YidC function presents several challenges:

  • Structural variations: While the core function is conserved, YidC proteins from different bacterial species may contain structural adaptations for specific substrates or environments

  • Expression challenges: Heterologous expression of Prosthecochloris aestuarii YidC may require codon optimization and specialized expression systems

  • Functional conservation assessment: Complementation studies in conditional YidC depletion strains (like E. coli JS7131) can determine if Prosthecochloris aestuarii YidC can rescue growth defects

  • Substrate specificity differences: Natural substrates may differ between species, requiring standardized model substrates for comparative studies

  • Membrane composition effects: The lipid environment may significantly influence YidC function, necessitating reconstitution in native-like membrane compositions

Researchers addressing these challenges should employ comparative biochemical analysis, complementation studies, and bioinformatic approaches to understand the evolutionary conservation and divergence of YidC function across bacterial species.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.